TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000004_1.0 # Protein # Glutathione peroxidase 1 (GPx1) # Homo sapiens # Complete (203 letters) Database: A.taiwanensis/genome.fa 5379 sequences; 6,149,411 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABJQ01000559.1| Ascogregarina taiwanensis Contig671, whole ge... 27 1.3 gb|ABJQ01001990.1| Ascogregarina taiwanensis Contig2252, whole g... 27 1.6 gb|ABJQ01004651.1| Ascogregarina taiwanensis CLRanP152-F05.b1.ab... 26 3.7 gb|ABJQ01003202.1| Ascogregarina taiwanensis Contig3536, whole g... 25 4.8 gb|ABJQ01003200.1| Ascogregarina taiwanensis Contig3534, whole g... 25 6.3 gb|ABJQ01002750.1| Ascogregarina taiwanensis Contig3068, whole g... 25 6.3 gb|ABJQ01000019.1| Ascogregarina taiwanensis Contig19, whole gen... 25 8.2 >gb|ABJQ01000559.1| Ascogregarina taiwanensis Contig671, whole genome shotgun sequence Length = 901 Score = 27.3 bits (59), Expect = 1.3 Identities = 18/82 (21%), Positives = 33/82 (40%), Gaps = 5/82 (6%) Frame = +1 Query: 16 VYAFSARPLAGGEPVSLGSLR---GKVLLIENVASLXGTTVRDYTQMNE--LQRRLGPRG 70 ++ F+ RPL PV + R + L + + G + ++ P G Sbjct: 358 LFGFATRPLINPAPVLVAGARFFSAEASLAQPAVTQAGLNAPTSIVIGNKITGTKVAPEG 537 Query: 71 LVVLGFPCNQFGHQENAKNEEI 92 +LGF CN+ H+ K ++ Sbjct: 538 QYILGFTCNKCDHRTARKFSKV 603 >gb|ABJQ01001990.1| Ascogregarina taiwanensis Contig2252, whole genome shotgun sequence Length = 1639 Score = 26.9 bits (58), Expect = 1.6 Identities = 18/50 (36%), Positives = 22/50 (44%), Gaps = 8/50 (16%) Frame = +1 Query: 132 ALPAPSDDATALMTDPKLITWSPVCRN------DVAWNFEKF--LVGPDG 173 +LPA +D L TDP +PVC N D W+ L GP G Sbjct: 1042 SLPACLEDVLQLQTDPLARRTAPVCPNGEQCSCDEVWDSNDMYTLAGPVG 1191 >gb|ABJQ01004651.1| Ascogregarina taiwanensis CLRanP152-F05.b1.ab1, whole genome shotgun sequence Length = 713 Score = 25.8 bits (55), Expect = 3.7 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 134 PAPSDDATALMTDPKLITW 152 P P D +L+ DP+L TW Sbjct: 155 PVPGDYVQSLLVDPRLETW 99 >gb|ABJQ01003202.1| Ascogregarina taiwanensis Contig3536, whole genome shotgun sequence Length = 2456 Score = 25.4 bits (54), Expect = 4.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 17 YAFSARPLAGGEPVSLGSLRGKVLLI 42 Y + PLAGG P+S+GS R + L + Sbjct: 1710 YRSTDGPLAGGCPISMGSGRRRRLTV 1787 >gb|ABJQ01003200.1| Ascogregarina taiwanensis Contig3534, whole genome shotgun sequence Length = 2982 Score = 25.0 bits (53), Expect = 6.3 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +2 Query: 23 PLAGGEPVSLGSLRGKVLLI 42 PLAGG P+S+GS R + L + Sbjct: 2528 PLAGGCPISMGSGRRRRLTV 2587 >gb|ABJQ01002750.1| Ascogregarina taiwanensis Contig3068, whole genome shotgun sequence Length = 1923 Score = 25.0 bits (53), Expect = 6.3 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 7/45 (15%) Frame = +3 Query: 56 YTQMNELQRRL-GPRGLVVLGF------PCNQFGHQENAKNEEIL 93 YT +E + + G RG V+ F PC+ GHQ K + +L Sbjct: 1296 YTVCHEKREEI*GSRGNVISPFSGIHFSPCHILGHQRGCKADPVL 1430 >gb|ABJQ01000019.1| Ascogregarina taiwanensis Contig19, whole genome shotgun sequence Length = 790 Score = 24.6 bits (52), Expect = 8.2 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -2 Query: 135 APSDDATALMTDPKLITWSPVCRNDVAWNF 164 AP + +T+ L++W P C + V NF Sbjct: 576 APVISGS*FVTNVTLVSWDPACSHAVGPNF 487 Database: A.taiwanensis/genome.fa Posted date: Feb 9, 2011 9:02 AM Number of letters in database: 6,149,411 Number of sequences in database: 5379 Lambda K H 0.321 0.139 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,478,592 Number of Sequences: 5379 Number of extensions: 22538 Number of successful extensions: 113 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of query: 203 length of database: 2,049,803 effective HSP length: 83 effective length of query: 120 effective length of database: 1,603,346 effective search space: 192401520 effective search space used: 192401520 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)