TBLASTN 2.2.13 [Nov-27-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= SPP00000059_1.0 # Protein # Selenoprotein R  (SelR) #
Caenorhabditis elegans # Complete
         (152 letters)

Database: C.parvum/genome.fa 
           8 sequences; 9,102,324 total letters

Searching........done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb|CM000430.1| Cryptosporidium parvum Iowa II chromosome 2, whol...    30   0.16 

>gb|CM000430.1| Cryptosporidium parvum Iowa II chromosome 2, whole genome shotgun
              sequence
          Length = 985969

 Score = 30.4 bits (67), Expect = 0.16
 Identities = 14/47 (29%), Positives = 20/47 (42%)
 Frame = -2

Query: 42     ARESGTETPHTGGFNDHFEKGRYVCLCCGSELFNSDAKFWAGCGWPA 88
              +R  G     TG    H  K  ++C  CG   +    K  A CG+P+
Sbjct: 445356 SRNMGKAGKGTGSRGKHHGKTHFLCRRCGQRSYMVQKKRCASCGYPS 445216


  Database: C.parvum/genome.fa
    Posted date:  Feb 9, 2011  9:02 AM
  Number of letters in database: 9,102,324
  Number of sequences in database:  8
  
Lambda     K      H
   0.318    0.134    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,413,698
Number of Sequences: 8
Number of extensions: 16912
Number of successful extensions: 67
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 66
Number of HSP's gapped (non-prelim): 8
length of query: 152
length of database: 3,034,108
effective HSP length: 83
effective length of query: 69
effective length of database: 3,033,444
effective search space: 209307636
effective search space used: 209307636
frameshift window, decay const: 40,  0.1
T: 13
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)