TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000059_1.0 # Protein # Selenoprotein R (SelR) # Caenorhabditis elegans # Complete (152 letters) Database: A.taiwanensis/genome.fa 5379 sequences; 6,149,411 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|284816055|gb|ABJQ01003852.1| Ascogregarina taiwanensis CLRanP... 48 6e-07 gi|284817592|gb|ABJQ01002315.1| Ascogregarina taiwanensis Contig... 30 0.092 gi|284816747|gb|ABJQ01003160.1| Ascogregarina taiwanensis Contig... 30 0.16 gi|284815431|gb|ABJQ01004476.1| Ascogregarina taiwanensis CLRanP... 29 0.27 gi|284817080|gb|ABJQ01002827.1| Ascogregarina taiwanensis Contig... 28 0.60 gi|284816659|gb|ABJQ01003248.1| Ascogregarina taiwanensis Contig... 25 3.0 gi|284819567|gb|ABJQ01000340.1| Ascogregarina taiwanensis Contig... 25 3.0 gi|284815818|gb|ABJQ01004089.1| Ascogregarina taiwanensis CLRanP... 25 5.0 gi|284817919|gb|ABJQ01001988.1| Ascogregarina taiwanensis Contig... 25 5.0 gi|284819509|gb|ABJQ01000398.1| Ascogregarina taiwanensis Contig... 25 5.0 gi|284815685|gb|ABJQ01004222.1| Ascogregarina taiwanensis CLRanP... 24 8.6 gi|284815987|gb|ABJQ01003920.1| Ascogregarina taiwanensis CLRanP... 24 8.6 gi|284817059|gb|ABJQ01002848.1| Ascogregarina taiwanensis Contig... 24 8.6 gi|284818193|gb|ABJQ01001714.1| Ascogregarina taiwanensis Contig... 24 8.6 >gi|284816055|gb|ABJQ01003852.1| Ascogregarina taiwanensis CLRanP95-E06.b1.ab1, whole genome shotgun sequence Length = 894 Score = 47.8 bits (112), Expect = 6e-07 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 13/66 (19%) Frame = -1 Query: 39 YRVARESGTETP-HT-----------GGFNDHF-EKGRYVCLCCGSELFNSDAKFWAGCG 85 Y V R TE+P HT G +N + ++G +VC CG L+++ AKF +GCG Sbjct: 621 YAVIRLKDTESPGHTSARSSSVPNISGEYNKFYPQEGHFVCKGCGEPLYSAAAKFDSGCG 442 Query: 86 WPAFSE 91 WPAF + Sbjct: 441 WPAFDK 424 >gi|284817592|gb|ABJQ01002315.1| Ascogregarina taiwanensis Contig2613, whole genome shotgun sequence Length = 3192 Score = 30.4 bits (67), Expect = 0.092 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -1 Query: 52 TGGFNDHFEKGRYVCLCCGSELFNSDAKFWAGCG 85 TG F K ++C+ CG F+ K A CG Sbjct: 3042 TGSFGKRHGKSHFLCIRCGRRAFHLQKKTCASCG 2941 >gi|284816747|gb|ABJQ01003160.1| Ascogregarina taiwanensis Contig3494, whole genome shotgun sequence Length = 2248 Score = 29.6 bits (65), Expect = 0.16 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +1 Query: 41 VARESGTETPHTGGFNDHFEKGRYVCLCCGSELFNSDAKFWAGCG 85 V SG+ G+++H +G+ LCC N A+ W G G Sbjct: 568 VVSRSGSSNFQLSGYDEH*TEGKVQILCCVVCAKNIHARVWRGQG 702 >gi|284815431|gb|ABJQ01004476.1| Ascogregarina taiwanensis CLRanP146-F04.b1.ab1, whole genome shotgun sequence Length = 743 Score = 28.9 bits (63), Expect = 0.27 Identities = 17/60 (28%), Positives = 23/60 (38%), Gaps = 1/60 (1%) Frame = -3 Query: 59 FEKGRYVCLCCGSELFN-SDAKFWAGCGWPAFSESVGQDANIVRIVDRSHGMHRTEVRCK 117 F R CL C F S FW G G +G+ + + R D H +RC+ Sbjct: 462 FMAKRLACLQCNIPRFQISQRHFWHGVGKFCVCLLIGRLSRVCRYFDTRHSAANDALRCR 283 >gi|284817080|gb|ABJQ01002827.1| Ascogregarina taiwanensis Contig3148, whole genome shotgun sequence Length = 2388 Score = 27.7 bits (60), Expect = 0.60 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -3 Query: 35 PNEVYRVARESGTETPHTGGFNDHFEKGRYVCL 67 PNE+ RVA+ G T GG+N + K +VC+ Sbjct: 1840 PNEICRVAKIFGEVT---GGYNLFWSKTNFVCV 1751 >gi|284816659|gb|ABJQ01003248.1| Ascogregarina taiwanensis Contig3583, whole genome shotgun sequence Length = 2695 Score = 25.4 bits (54), Expect = 3.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -2 Query: 67 LCCGSELFNSDAKFWAGCGW 86 +CC S F S+ + A CGW Sbjct: 1914 ICCRSPRFKSNRQPCAACGW 1855 >gi|284819567|gb|ABJQ01000340.1| Ascogregarina taiwanensis Contig426, whole genome shotgun sequence Length = 1490 Score = 25.4 bits (54), Expect = 3.0 Identities = 20/69 (28%), Positives = 36/69 (52%), Gaps = 7/69 (10%) Frame = -3 Query: 7 RMEDVGLSKLKVEKNPKD---VKQTEWKSVLPNEVYRVARESGTETP----HTGGFNDHF 59 R GLS+LKV KN D + +T+ K+++ + ++ E+ + P H+G N + Sbjct: 954 RRPHCGLSRLKVMKNSGD*ITMPKTKKKTIILSRRLQIYSENFFDFPATNLHSGDSNSN- 778 Query: 60 EKGRYVCLC 68 K R++ C Sbjct: 777 -KRRFLA*C 754 >gi|284815818|gb|ABJQ01004089.1| Ascogregarina taiwanensis CLRanP166-G02.g1.ab1, whole genome shotgun sequence Length = 778 Score = 24.6 bits (52), Expect = 5.0 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +2 Query: 27 QTEWKSVLPNEVYRVARESGTETPHTGG 54 +TE PN + R RE PH+GG Sbjct: 302 RTEASR*SPNSLRRAYREQSASYPHSGG 385 >gi|284817919|gb|ABJQ01001988.1| Ascogregarina taiwanensis Contig2250, whole genome shotgun sequence Length = 1608 Score = 24.6 bits (52), Expect = 5.0 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = -3 Query: 45 SGTETPHTGGFNDHFEKGRYVCLCCGSELFNSDAKFWAGC 84 +GT T H F+ R C CCGS + D + C Sbjct: 604 TGTLTLHCTVFDVRRPWRRIRCSCCGSNIRTQDQRSSGKC 485 >gi|284819509|gb|ABJQ01000398.1| Ascogregarina taiwanensis Contig489, whole genome shotgun sequence Length = 1301 Score = 24.6 bits (52), Expect = 5.0 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +2 Query: 46 GTETPHTGGFNDHFEKGRYVCLCCG 70 G +TP ND +E YVCLCCG Sbjct: 779 GQDTPG----NDLYEL--YVCLCCG 835 >gi|284815685|gb|ABJQ01004222.1| Ascogregarina taiwanensis CLRanP76-D02.g1.ab1, whole genome shotgun sequence Length = 919 Score = 23.9 bits (50), Expect = 8.6 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +3 Query: 68 CCGSELFNSDAKFWA 82 CC S++ SD FWA Sbjct: 567 CCLSKIHRSDPSFWA 611 >gi|284815987|gb|ABJQ01003920.1| Ascogregarina taiwanensis CLRanP128-H01.g1.ab1, whole genome shotgun sequence Length = 416 Score = 23.9 bits (50), Expect = 8.6 Identities = 11/26 (42%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Frame = +1 Query: 64 YVCLC-CGSELFNSDAKFWAGCGWPA 88 Y+CL +L N +FW G WPA Sbjct: 94 YICLP*VFIQLRNPFLEFWCGARWPA 171 >gi|284817059|gb|ABJQ01002848.1| Ascogregarina taiwanensis Contig3169, whole genome shotgun sequence Length = 3273 Score = 23.9 bits (50), Expect = 8.6 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +3 Query: 89 FSESVGQDANIVRIVDRSHGMHRTEVRC 116 FSE+ G + RI RS HR RC Sbjct: 3168 FSETTGDGMSGARIRTRSISEHRGPARC 3251 >gi|284818193|gb|ABJQ01001714.1| Ascogregarina taiwanensis Contig1956, whole genome shotgun sequence Length = 1218 Score = 23.9 bits (50), Expect = 8.6 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +2 Query: 101 RIVDRSHGMHRTEVRCKTCDAHLGHVFNDGPKETTGER 138 +IV RSH H +C+ C+ PK+TT ++ Sbjct: 278 KIVHRSHETHVWLRQCEDCNHLYPRTKKTTPKKTTPKK 391 Database: A.taiwanensis/genome.fa Posted date: Mar 3, 2011 3:00 PM Number of letters in database: 6,149,411 Number of sequences in database: 5379 Lambda K H 0.318 0.134 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,288,922 Number of Sequences: 5379 Number of extensions: 19982 Number of successful extensions: 112 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of query: 152 length of database: 2,049,803 effective HSP length: 79 effective length of query: 73 effective length of database: 1,624,862 effective search space: 118614926 effective search space used: 118614926 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)