BLASTP 2.2.25+
Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro
A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and
David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new
generation of protein database search programs", Nucleic
Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Stephen
F. Altschul, John C. Wootton, E. Michael Gertz, Richa
Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and
Yi-Kuo Yu (2005) "Protein database searches using
compositionally adjusted substitution matrices", FEBS J.
272:5101-5109.


RID: RHB5BZ96014


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects
           13,355,011 sequences; 4,573,799,928 total letters
Query= 
Length=43


                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|XP_002124840.1|  PREDICTED: similar to Y26D4A.9, partial [...  34.7    4.5  

ALIGNMENTS
>ref|XP_002124840.1| PREDICTED: similar to Y26D4A.9, partial [Ciona intestinalis]
Length=1865

 Score = 34.7 bits (78),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 16/39 (42%), Positives = 20/39 (52%), Gaps = 0/39 (0%)

Query  5     RCYIHSVGRIQPFLYKDLVKTNPQVSHAEANTQYFEVLS  43
             R  I  V +I P +YKDL KT   V   +AN  Y   L+
Sbjct  1054  RLQIKDVTKINPLIYKDLAKTTKSVQGVDANGLYLSCLT  1092


  Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF
excluding environmental samples from WGS projects
    Posted date:  Mar 9, 2011  6:13 PM
  Number of letters in database: 278,832,632
  Number of sequences in database:  13,355,011

Lambda     K      H
   0.322    0.135    0.396 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13355011
Number of Hits to DB: 34133217
Number of extensions: 716527
Number of successful extensions: 1262
Number of sequences better than 100: 0
Number of HSP's better than 100 without gapping: 0
Number of HSP's gapped: 1262
Number of HSP's successfully gapped: 0
Length of query: 43
Length of database: 4573799928
Length adjustment: 17
Effective length of query: 26
Effective length of database: 4346764741
Effective search space: 113015883266
Effective search space used: 113015883266
T: 11
A: 40
X1: 16 (7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (20.4 bits)
S2: 67 (30.4 bits)