TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000057_1.0 # Protein # Selenoprotein 15 (Sel15) # Caenorhabditis elegans # Complete (152 letters) Database: genome.fa 5578 sequences; 78,051,097 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAQY01001160.1| Phytophthora sojae strain P6497 Psojae_Cont11... 44 1e-04 gb|AAQY01004650.1| Phytophthora sojae strain P6497 Psojae_Cont46... 31 0.64 gb|AAQY01000962.1| Phytophthora sojae strain P6497 Psojae_Cont96... 31 0.64 gb|AAQY01004218.1| Phytophthora sojae strain P6497 Psojae_Cont42... 29 3.2 gb|AAQY01000926.1| Phytophthora sojae strain P6497 Psojae_Cont92... 28 7.0 gb|AAQY01000204.1| Phytophthora sojae strain P6497 Psojae_Cont20... 27 9.2 >gb|AAQY01001160.1| Phytophthora sojae strain P6497 Psojae_Cont1160, whole genome shotgun sequence Length = 110087 Score = 43.5 bits (101), Expect = 1e-04 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 17/88 (19%) Frame = -3 Query: 26 VEECKAAGFNPETLKCGLCERLSDY--------------HLETLLTDCLQCC---IKEEE 68 +E C GF+ + L C LC+ LS Y ++ + ++C CC K E Sbjct: 14544 LERCAMLGFDADALDCRLCDDLSTYLGSVKSTKKKPKQKAVDLVTSECRDCCSDFSKVLE 14365 Query: 69 FKHEKYPTAILEVCECNLARFPQVQAFV 96 + +Y A+L V + L R+P+V FV Sbjct: 14364 AEGRRYAKAVLAVSQHRLKRYPKVANFV 14281 >gb|AAQY01004650.1| Phytophthora sojae strain P6497 Psojae_Cont4650, whole genome shotgun sequence Length = 2230 Score = 31.2 bits (69), Expect = 0.64 Identities = 15/57 (26%), Positives = 25/57 (43%) Frame = +1 Query: 42 GLCERLSDYHLETLLTDCLQCCIKEEEFKHEKYPTAILEVCECNLARFPQVQAFVHK 98 G ERL + L T + +CC+ + P + E C C PQV+ ++ + Sbjct: 169 GARERLFTWSLYTPASSIKKCCVPRHTLTETRKPVCVTEGCHCT----PQVKEYLQR 327 >gb|AAQY01000962.1| Phytophthora sojae strain P6497 Psojae_Cont962, whole genome shotgun sequence Length = 64459 Score = 31.2 bits (69), Expect = 0.64 Identities = 15/57 (26%), Positives = 25/57 (43%) Frame = -2 Query: 42 GLCERLSDYHLETLLTDCLQCCIKEEEFKHEKYPTAILEVCECNLARFPQVQAFVHK 98 G ERL + L T + +CC+ + P + E C C PQV+ ++ + Sbjct: 47844 GARERLFTWSLYTPASSIKKCCVPRHTLTETRKPVCVTEGCHCT----PQVKEYLQR 47686 >gb|AAQY01004218.1| Phytophthora sojae strain P6497 Psojae_Cont4218, whole genome shotgun sequence Length = 5908 Score = 28.9 bits (63), Expect = 3.2 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = +1 Query: 37 ETLKCGLCERLSDYHLETLLTDC--LQCCIKEEEFKHEKYPTAILEVCECNLARFPQV 92 ++L+C CE L+ Y + C LQ ++++ KH T I C+ N A+ P V Sbjct: 1012 QSLRCSTCEALAQYKNRDISFRCAKLQSEVQKKSSKH----TTITICCKVNKAQCPIV 1173 >gb|AAQY01000926.1| Phytophthora sojae strain P6497 Psojae_Cont926, whole genome shotgun sequence Length = 458946 Score = 27.7 bits (60), Expect = 7.0 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -2 Query: 42 GLCERLSDYHLETLLTDCLQCCIKEEEFKHEKYPTAILEV 81 G+ + L L LLT C+ EE + ++YP +L+V Sbjct: 48842 GMIDCLLAVSLTQLLTVCVNLSFGSEETRSQRYPLLVLQV 48723 >gb|AAQY01000204.1| Phytophthora sojae strain P6497 Psojae_Cont204, whole genome shotgun sequence Length = 154784 Score = 27.3 bits (59), Expect = 9.2 Identities = 20/74 (27%), Positives = 29/74 (39%), Gaps = 17/74 (22%) Frame = -1 Query: 29 CKAAGFNPETLKCGLCERLSDYHLE-----------------TLLTDCLQCCIKEEEFKH 71 CK GF P +C+ + +L+ TLL L C ++ Sbjct: 14471 CKM*GFCPLIAH*SVCKSATSANLDGCEGKVRVRNASKPIYSTLLAPTLFCSDYTDKMT* 14292 Query: 72 EKYPTAILEVCECN 85 KY + +LEVC CN Sbjct: 14291 LKYTSKLLEVCYCN 14250 Database: genome.fa Posted date: Jan 19, 2010 5:09 PM Number of letters in database: 78,051,097 Number of sequences in database: 5578 Lambda K H 0.324 0.138 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,319,872 Number of Sequences: 5578 Number of extensions: 202836 Number of successful extensions: 1114 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 276 Number of HSP's successfully gapped in prelim test: 54 Number of HSP's that attempted gapping in prelim test: 758 Number of HSP's gapped (non-prelim): 537 length of query: 152 length of database: 26,017,032 effective HSP length: 97 effective length of query: 55 effective length of database: 25,475,966 effective search space: 1401178130 effective search space used: 1401178130 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 59 (27.3 bits)