TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000011_1.0 # Protein # Glutathione peroxidase 8 (GPx8) # Homo sapiens # Complete (209 letters) Database: bd_brevicollis 218 sequences; 41,633,360 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value scaffold_2 47 1e-05 scaffold_22 38 0.008 scaffold_30 28 6.0 scaffold_24 28 7.8 >scaffold_2 Length = 3607471 Score = 47.4 bits (111), Expect = 1e-05 Identities = 18/48 (37%), Positives = 30/48 (62%) Frame = +1 Query: 82 TDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESFARKN 129 T +Y G+ +L+ + F++LAFPCNQ+ + EP+ + +E F R N Sbjct: 1134337 TKMSYEGMSKLYTRYAHQPFTILAFPCNQYDKQEPKSNANIEKFVRGN 1134480 Score = 28.1 bits (61), Expect = 6.0 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +3 Query: 13 GPRAKVFAVLLSIVLCTVTLFLLQLKFLKPKINSFYAFE 51 GPR +A+LLS+V C L L P ++ E Sbjct: 1369635 GPRIGAYAILLSVVPCWALALLFSSSHLAPVVSHLVLLE 1369751 >scaffold_22 Length = 692295 Score = 37.7 bits (86), Expect = 0.008 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = +2 Query: 68 KVSLVVNVASD*QLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGE 113 +V ++VN A L RN+ + ELH ++ F ++AFP N F + Sbjct: 341042 QVVMIVNTAGQCGLAQRNFTEMVELHDKYKDQGFEIVAFPSNSFNQ 341179 >scaffold_30 Length = 568742 Score = 28.1 bits (61), Expect = 6.0 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = +1 Query: 4 LAAYPLKCSGPRAKVFAVLLSIVLCTVTLFLLQLKFLKPKINSFYAFE 51 LA +PLKC+ + A +LC V L +++ L I + FE Sbjct: 87574 LAKHPLKCTSSHPPMSAENKRAILCKVQLSRKEIQQLTEAIEDLFYFE 87717 >scaffold_24 Length = 679602 Score = 27.7 bits (60), Expect = 7.8 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +3 Query: 146 EGEPAFRFLVDSSKKEPRWNFWKYLVN 172 +G P L +S EP W FW + V+ Sbjct: 410817 QGSPKMHRLTKASHSEPDWQFWVHCVS 410897 Database: bd_brevicollis Posted date: Feb 25, 2010 1:30 PM Number of letters in database: 41,633,360 Number of sequences in database: 218 Lambda K H 0.324 0.141 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,142,751 Number of Sequences: 218 Number of extensions: 138447 Number of successful extensions: 682 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 647 Number of HSP's gapped (non-prelim): 94 length of query: 209 length of database: 13,877,786 effective HSP length: 97 effective length of query: 112 effective length of database: 13,856,640 effective search space: 1551943680 effective search space used: 1551943680 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 59 (27.3 bits)