TBLASTN 2.2.13 [Nov-27-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= SPP00000010_1.0 # Protein # Glutathione peroxidase 7 (GPx7) #
Homo sapiens # Complete
         (187 letters)

Database: bd_bovis 
           13 sequences; 8,173,701 total letters

Searching.............done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|154798391|gb|AAXT01000001.1| Babesia bovis strain T2Bo chromo...    26   5.3  
gi|154795865|gb|AAXT01000010.1| Babesia bovis strain T2Bo chromo...    25   9.0  
gi|154795870|gb|AAXT01000009.1| Babesia bovis strain T2Bo chromo...    25   9.0  
gi|154796031|gb|AAXT01000005.1| Babesia bovis strain T2Bo chromo...    25   9.0  
gi|154796781|gb|AAXT01000003.1| Babesia bovis strain T2Bo chromo...    25   9.0  

>gi|154798391|gb|AAXT01000001.1| Babesia bovis strain T2Bo chromosome 3
              gcontig_1104837696278, whole genome shotgun sequence
          Length = 2593320

 Score = 25.8 bits (55), Expect = 5.3
 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 1/59 (1%)
 Frame = +2

Query: 115    FSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTV-SVEEVRPQI 172
              F  +AVT    +P F Y A++ G    W    +  +P  K +G     V SV E R  I
Sbjct: 501698 FLNMAVTSAFVNPGFLYNAKSIGNHIHWCHRAHKASPFYKKLGCHSQGVPSVVEARDVI 501874



 Score = 25.8 bits (55), Expect = 5.3
 Identities = 11/18 (61%), Positives = 13/18 (72%)
 Frame = +1

Query: 2       VAATVAAAWLLLWAAACA 19
               V A + AAWLL + AACA
Sbjct: 1739497 VVAGIYAAWLLAYLAACA 1739550


>gi|154795865|gb|AAXT01000010.1| Babesia bovis strain T2Bo chromosome 1
             gcontig_1104837696282, whole genome shotgun sequence
          Length = 13770

 Score = 25.0 bits (53), Expect = 9.0
 Identities = 9/15 (60%), Positives = 10/15 (66%)
 Frame = +2

Query: 142   WNFWKYLVAPDGKVV 156
             WN+W  LV   GKVV
Sbjct: 12530 WNWWSILVGGSGKVV 12574


>gi|154795870|gb|AAXT01000009.1| Babesia bovis strain T2Bo chromosome 1
             gcontig_1104837696189, whole genome shotgun sequence
          Length = 15708

 Score = 25.0 bits (53), Expect = 9.0
 Identities = 9/15 (60%), Positives = 10/15 (66%)
 Frame = +3

Query: 142   WNFWKYLVAPDGKVV 156
             WN+W  LV   GKVV
Sbjct: 15507 WNWWSILVGGSGKVV 15551


>gi|154796031|gb|AAXT01000005.1| Babesia bovis strain T2Bo chromosome 1
              gcontig_1104837696198, whole genome shotgun sequence
          Length = 821816

 Score = 25.0 bits (53), Expect = 9.0
 Identities = 9/15 (60%), Positives = 10/15 (66%)
 Frame = +1

Query: 142    WNFWKYLVAPDGKVV 156
              WN+W  LV   GKVV
Sbjct: 676363 WNWWSILVGGSGKVV 676407



 Score = 25.0 bits (53), Expect = 9.0
 Identities = 9/15 (60%), Positives = 10/15 (66%)
 Frame = +3

Query: 142    WNFWKYLVAPDGKVV 156
              WN+W  LV   GKVV
Sbjct: 800190 WNWWSILVGGSGKVV 800234


>gi|154796781|gb|AAXT01000003.1| Babesia bovis strain T2Bo chromosome 2
             gcontig_1104837696614, whole genome shotgun sequence
          Length = 1729419

 Score = 25.0 bits (53), Expect = 9.0
 Identities = 9/15 (60%), Positives = 11/15 (73%)
 Frame = +1

Query: 138   KEPTWNFWKYLVAPD 152
             ++PTWN  KYL  PD
Sbjct: 99742 RQPTWNDLKYLPDPD 99786


  Database: bd_bovis
    Posted date:  Feb 25, 2010 11:15 AM
  Number of letters in database: 8,173,701
  Number of sequences in database:  13
  
Lambda     K      H
   0.324    0.135    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,770,725
Number of Sequences: 13
Number of extensions: 21954
Number of successful extensions: 110
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 87
Number of HSP's gapped (non-prelim): 40
length of query: 187
length of database: 2,724,567
effective HSP length: 85
effective length of query: 102
effective length of database: 2,723,462
effective search space: 277793124
effective search space used: 277793124
frameshift window, decay const: 40,  0.1
T: 13
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (25.0 bits)