TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000011_1.0 # Protein # Glutathione peroxidase 8 (GPx8) # Homo sapiens # Complete (209 letters) Database: bd_annulata 8 sequences; 8,358,125 total letters Searching........done Score E Sequences producing significant alignments: (bits) Value gi|71533066|emb|CR940352.2| Theileria annulata strain Ankara iso... 28 1.3 gi|65304547|emb|CR940347.1| Theileria annulata strain Ankara iso... 26 5.0 gi|65301918|emb|CR940348.1| Theileria annulata strain Ankara iso... 25 8.5 >gi|71533066|emb|CR940352.2| Theileria annulata strain Ankara isolate clone C9, *** SEQUENCING IN PROGRESS ***, 3 ordered pieces Length = 1898942 Score = 28.1 bits (61), Expect = 1.3 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 109 NQFGESEPRPSKEVESFARKNYGVTFPIF 137 NQ GES+ RPS SF N+ + PI+ Sbjct: 1550719 NQLGESQGRPSITF*SFNHTNFFIFIPIY 1550805 >gi|65304547|emb|CR940347.1| Theileria annulata strain Ankara isolate clone C9, *** SEQUENCING IN PROGRESS *** Length = 2592520 Score = 26.2 bits (56), Expect = 5.0 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = -1 Query: 12 SGPRAKVFAVLLSIVLCTVTLFLLQLKFLKPKINSFYAF 50 +G A+ VLLSI + T+ L L K PK SF+ F Sbjct: 1395871 TGAIARSEQVLLSITVATLYL*LHSSKSFPPKQTSFFPF 1395755 >gi|65301918|emb|CR940348.1| Theileria annulata strain Ankara isolate clone C9, *** SEQUENCING IN PROGRESS *** Length = 1979170 Score = 25.4 bits (54), Expect = 8.5 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = -1 Query: 16 AKVFAVLLSIVLCTVTLFLLQLKF 39 +K+F ++L I+L + LFLL K+ Sbjct: 285442 SKIFFIILYIILLILILFLLHYKY 285371 Database: bd_annulata Posted date: Feb 25, 2010 11:01 AM Number of letters in database: 8,358,125 Number of sequences in database: 8 Lambda K H 0.324 0.141 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,990,801 Number of Sequences: 8 Number of extensions: 28634 Number of successful extensions: 132 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 79 Number of HSP's gapped (non-prelim): 87 length of query: 209 length of database: 2,786,041 effective HSP length: 87 effective length of query: 122 effective length of database: 2,785,345 effective search space: 339812090 effective search space used: 339812090 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 53 (25.0 bits)