TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000010_1.0 # Protein # Glutathione peroxidase 7 (GPx7) # Homo sapiens # Complete (187 letters) Database: bd_annulata 8 sequences; 8,358,125 total letters Searching........done Score E Sequences producing significant alignments: (bits) Value gi|65301918|emb|CR940348.1| Theileria annulata strain Ankara iso... 27 3.2 gi|71533066|emb|CR940352.2| Theileria annulata strain Ankara iso... 25 9.3 >gi|65301918|emb|CR940348.1| Theileria annulata strain Ankara isolate clone C9, *** SEQUENCING IN PROGRESS *** Length = 1979170 Score = 26.6 bits (57), Expect = 3.2 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 79 FNVLAFPCNQFGQQEPDSNKEIESFARRTYS 109 FN++ C +FG+ P N EI +F +R S Sbjct: 89219 FNLIKISCGRFGKSNP--NVEISTFDKRLLS 89305 >gi|71533066|emb|CR940352.2| Theileria annulata strain Ankara isolate clone C9, *** SEQUENCING IN PROGRESS ***, 3 ordered pieces Length = 1898942 Score = 25.0 bits (53), Expect = 9.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 71 QRDLGPHHFNVLAFPCNQFGQQEPDSNKEIES 102 QR + H F+ L F +FG +P+ KE S Sbjct: 407027 QRTVHAHFFSELYFLTGRFGNPKPNFEKEHSS 406932 Database: bd_annulata Posted date: Feb 25, 2010 11:01 AM Number of letters in database: 8,358,125 Number of sequences in database: 8 Lambda K H 0.324 0.135 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,624,864 Number of Sequences: 8 Number of extensions: 18942 Number of successful extensions: 81 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 75 Number of HSP's gapped (non-prelim): 15 length of query: 187 length of database: 2,786,041 effective HSP length: 85 effective length of query: 102 effective length of database: 2,785,361 effective search space: 284106822 effective search space used: 284106822 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 53 (25.0 bits)