TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000005_1.0 # Protein # Glutathione peroxidase 2 (GPx2) # Homo sapiens # Complete (190 letters) Database: bd_annulata 8 sequences; 8,358,125 total letters Searching........done Score E Sequences producing significant alignments: (bits) Value gi|65303699|emb|CR940353.1| Theileria annulata strain Ankara iso... 28 1.1 gi|71533066|emb|CR940352.2| Theileria annulata strain Ankara iso... 28 1.5 gi|65304547|emb|CR940347.1| Theileria annulata strain Ankara iso... 27 1.9 gi|65301918|emb|CR940348.1| Theileria annulata strain Ankara iso... 25 7.3 >gi|65303699|emb|CR940353.1| Theileria annulata strain Ankara isolate clone C9, *** SEQUENCING IN PROGRESS *** Length = 1842271 Score = 28.1 bits (61), Expect = 1.1 Identities = 9/16 (56%), Positives = 14/16 (87%) Frame = +3 Query: 165 PFRRYSRTFPTINIEP 180 PF++ S +FPT+N+EP Sbjct: 550401 PFKKSSTSFPTVNVEP 550448 Score = 25.8 bits (55), Expect = 5.6 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -2 Query: 77 CQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFA 117 C +E+ILN + V G V ++NG E P+ A Sbjct: 227556 CISEKILNEIAVVTKTGESSNNIERVSTNDINGSKEAPIRA 227434 >gi|71533066|emb|CR940352.2| Theileria annulata strain Ankara isolate clone C9, *** SEQUENCING IN PROGRESS ***, 3 ordered pieces Length = 1898942 Score = 27.7 bits (60), Expect = 1.5 Identities = 18/64 (28%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Frame = +2 Query: 59 RRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQ-NEHPVFA 117 R L + FP N+ ++ N+ I +LKY+ GGY ++ EV G + ++ Sbjct: 1703084 RSLSIDYFPINRLSSRKKDYNQ-ITGTLKYLTQAGGYFKFMNHLRNLEVKGTFDPEDMYK 1703260 Query: 118 YLKD 121 YL + Sbjct: 1703261 YLDE 1703272 Score = 26.6 bits (57), Expect = 3.3 Identities = 22/67 (32%), Positives = 29/67 (43%), Gaps = 1/67 (1%) Frame = +2 Query: 58 PRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKC-EVNGQNEHPVF 116 P +L + F N+F NEEI+N LK G L +KC E+ N VF Sbjct: 1085765 PYQLNIEEFNINEFN------NEEIINKLKNFNEFGNLNEFVNLDKKCLEIKLFNVSTVF 1085926 Query: 117 AYLKDKL 123 K+ L Sbjct: 1085927 KIGKNSL 1085947 Score = 25.8 bits (55), Expect = 5.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 146 RRSDVAWNFEKFLIGPEGEP 165 R+ D+AWN EK L+ P+ P Sbjct: 509177 RKRDIAWNKEKHLLKPKK*P 509118 >gi|65304547|emb|CR940347.1| Theileria annulata strain Ankara isolate clone C9, *** SEQUENCING IN PROGRESS *** Length = 2592520 Score = 27.3 bits (59), Expect = 1.9 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 110 QNEHPVFAYLKDKLPYPYDDPFSLM 134 +N+ P YL+ K YPY P SLM Sbjct: 151654 RNQQPSHIYLRTKPLYPYQIPSSLM 151728 Score = 27.3 bits (59), Expect = 1.9 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 8/40 (20%) Frame = +1 Query: 127 YDDPFSLMTDPKLIIWSPVR--------RSDVAWNFEKFL 158 Y D F+L + KLI++SP+ +SD+ N+ +FL Sbjct: 2353510 YIDVFTLRKELKLILYSPIHKDSPYYRFKSDLVQNYNQFL 2353629 Score = 26.2 bits (56), Expect = 4.3 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 146 RRSDVAWNFEKFLIGPEGEP 165 R+ D+AWN EK L+ P+ P Sbjct: 1218033 RKKDIAWNKEKHLLKPKK*P 1218092 Score = 25.4 bits (54), Expect = 7.3 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -1 Query: 49 QLNELQCRFPRRLVVLGFP 67 +++E+ C FPR +V GFP Sbjct: 1407463 RVDEISCSFPRDIVSHGFP 1407407 >gi|65301918|emb|CR940348.1| Theileria annulata strain Ankara isolate clone C9, *** SEQUENCING IN PROGRESS *** Length = 1979170 Score = 25.4 bits (54), Expect = 7.3 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +1 Query: 64 LGFPCNQFGHQEN 76 LGFPC+ FG EN Sbjct: 1339693 LGFPCSVFGEDEN 1339731 Database: bd_annulata Posted date: Feb 25, 2010 11:01 AM Number of letters in database: 8,358,125 Number of sequences in database: 8 Lambda K H 0.323 0.141 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,775,474 Number of Sequences: 8 Number of extensions: 26745 Number of successful extensions: 112 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 65 Number of HSP's gapped (non-prelim): 84 length of query: 190 length of database: 2,786,041 effective HSP length: 85 effective length of query: 105 effective length of database: 2,785,361 effective search space: 292462905 effective search space used: 292462905 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (25.0 bits)