TBLASTN 2.2.13 [Nov-27-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= SPP00000004_1.0 # Protein # Glutathione peroxidase 1 (GPx1) #
Homo sapiens # Complete
         (203 letters)

Database: bd_annulata 
           8 sequences; 8,358,125 total letters

Searching........done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|71533066|emb|CR940352.2| Theileria annulata strain Ankara iso...    25   8.1  
gi|65301918|emb|CR940348.1| Theileria annulata strain Ankara iso...    25   8.1  

>gi|71533066|emb|CR940352.2| Theileria annulata strain Ankara isolate clone
               C9, *** SEQUENCING IN PROGRESS ***, 3 ordered pieces
          Length = 1898942

 Score = 25.4 bits (54), Expect = 8.1
 Identities = 13/50 (26%), Positives = 23/50 (46%)
 Frame = +1

Query: 153     SPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSC 202
               S  C  D+ W++E+F     G P+  Y + F  I ++   + L     +C
Sbjct: 1575835 SQFCSYDMDWHYERF-----GYPILPYMKDFTNIKMDSFYKDLNFDNKTC 1575969


>gi|65301918|emb|CR940348.1| Theileria annulata strain Ankara isolate clone
               C9, *** SEQUENCING IN PROGRESS ***
          Length = 1979170

 Score = 25.4 bits (54), Expect = 8.1
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = +1

Query: 74      LGFPCNQFGHQEN 86
               LGFPC+ FG  EN
Sbjct: 1339693 LGFPCSVFGEDEN 1339731


  Database: bd_annulata
    Posted date:  Feb 25, 2010 11:01 AM
  Number of letters in database: 8,358,125
  Number of sequences in database:  8
  
Lambda     K      H
   0.321    0.137    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,524,325
Number of Sequences: 8
Number of extensions: 19492
Number of successful extensions: 71
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 67
Number of HSP's gapped (non-prelim): 20
length of query: 203
length of database: 2,786,041
effective HSP length: 86
effective length of query: 117
effective length of database: 2,785,353
effective search space: 325886301
effective search space used: 325886301
frameshift window, decay const: 40,  0.1
T: 13
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)