TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SelTryp; hypothetical protein [Trypanosoma brucei TREU927] PARTIALLY FROM XP_844760.1 (259 letters) Database: genome.fa 10,690 sequences; 16,893,362 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAAJ01007675.1| Plasmodium chabaudi whole genome shotgun ass... 29 1.8 emb|CAAJ01001814.1| Plasmodium chabaudi whole genome shotgun ass... 29 1.8 >emb|CAAJ01007675.1| Plasmodium chabaudi whole genome shotgun assembly, contig PC_PH3074, whole genome shotgun sequence Length = 616 Score = 28.9 bits (63), Expect = 1.8 Identities = 26/79 (32%), Positives = 35/79 (44%), Gaps = 5/79 (6%) Frame = -1 Query: 101 RVEYCSGXGYRRHYEEVAESLLRSLPP----ELREQQKGKKPFIKFVGVVYSVGAFR-EF 155 R +Y Y + EE + L LPP R QQK K P V VVY+ F + Sbjct: 253 RFKYLPSAIY*AN*EENKKPLTNILPPFVYFSFRLQQKCKSPHFTLVLVVYAFNKFYVRW 74 Query: 156 IGNILSTGFLASIAISFFA 174 G ++ L I +SFF+ Sbjct: 73 YGR*INYFQL*GILLSFFS 17 >emb|CAAJ01001814.1| Plasmodium chabaudi whole genome shotgun assembly, contig PC_RP1977, whole genome shotgun sequence Length = 5757 Score = 28.9 bits (63), Expect = 1.8 Identities = 26/79 (32%), Positives = 35/79 (44%), Gaps = 5/79 (6%) Frame = +2 Query: 101 RVEYCSGXGYRRHYEEVAESLLRSLPP----ELREQQKGKKPFIKFVGVVYSVGAFR-EF 155 R +Y Y + EE + L LPP R QQK K P V VVY+ F + Sbjct: 4841 RFKYLPSAIY*AN*EENKKPLTNILPPFVYFSFRLQQKCKSPHFTLVLVVYAFNKFYVRW 5020 Query: 156 IGNILSTGFLASIAISFFA 174 G ++ L I +SFF+ Sbjct: 5021 YGR*INYFQL*GILLSFFS 5077 Database: genome.fa Posted date: Jan 16, 2009 12:51 PM Number of letters in database: 16,893,362 Number of sequences in database: 10,690 Lambda K H 0.321 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,533,149 Number of Sequences: 10690 Number of extensions: 39898 Number of successful extensions: 142 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 139 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 142 length of query: 259 length of database: 5,631,120 effective HSP length: 92 effective length of query: 167 effective length of database: 4,647,640 effective search space: 776155880 effective search space used: 776155880 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 57 (26.6 bits)