TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SelTryp; hypothetical protein [Trypanosoma brucei TREU927] PARTIALLY FROM XP_844760.1 (259 letters) Database: genome.fa 5966 sequences; 17,086,925 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAAI01000316.1| Plasmodium berghei whole genome shotgun asse... 28 2.5 emb|CAAI01005647.1| UNBERG.2.21787, whole genome shotgun sequence 27 5.6 emb|CAAI01004093.1| Plasmodium berghei whole genome shotgun asse... 27 9.6 emb|CAAI01002574.1| Plasmodium berghei whole genome shotgun asse... 27 9.6 >emb|CAAI01000316.1| Plasmodium berghei whole genome shotgun assembly, contig PB_RP0370, whole genome shotgun sequence Length = 1511 Score = 28.5 bits (62), Expect = 2.5 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -1 Query: 101 RVEYCSGXGYRRHYEEVAESLLRSLPP 127 RV CS YR HY + A LR +PP Sbjct: 365 RVHLCSPGCYRTHYVDQAGFRLRDMPP 285 >emb|CAAI01005647.1| UNBERG.2.21787, whole genome shotgun sequence Length = 1238 Score = 27.3 bits (59), Expect = 5.6 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -2 Query: 157 GNILSTGFLASIAISFFAPFL 177 G +LS FL+ ++ SFF+PFL Sbjct: 1171 GTLLSQPFLSFLSFSFFSPFL 1109 >emb|CAAI01004093.1| Plasmodium berghei whole genome shotgun assembly, contig PB_PH1455 UNBERG.2.3801, whole genome shotgun sequence Length = 1095 Score = 26.6 bits (57), Expect = 9.6 Identities = 28/99 (28%), Positives = 49/99 (49%) Frame = -3 Query: 39 SHRYKYLEMLKEADLKQMLHEKGEAFHHLRSKRELILAVLKLEKREEALRKARVTDTVQH 98 ++R K ++ ++E + K + K E +SKRE L + LEKR + K+ +T+ +Q Sbjct: 940 NYRKKTIKQVREMN-KPIQDIKMEIEPIKKSKRETTLQIENLEKRSGVIDKS-ITNRIQ- 770 Query: 99 EVRVEYCSGXGYRRHYEEVAESLLRSLPPELREQQKGKK 137 E+ E SG AE + ++ ++E K KK Sbjct: 769 EIE-ERISG----------AEDNIENIDTTVKENAKSKK 686 >emb|CAAI01002574.1| Plasmodium berghei whole genome shotgun assembly, contig PB_RP2939, whole genome shotgun sequence Length = 14230 Score = 26.6 bits (57), Expect = 9.6 Identities = 11/48 (22%), Positives = 25/48 (52%) Frame = -2 Query: 141 KFVGVVYSVGAFREFIGNILSTGFLASIAISFFAPFLRGALPPHIAEW 188 ++ +YS + + F N+ + F S+ +S F ++ + PHI ++ Sbjct: 6222 EYTNCIYSCASLKHFSHNVAAMYFFLSLTLSIF*LYIIIFIYPHIYKY 6079 Database: genome.fa Posted date: Jan 16, 2009 12:51 PM Number of letters in database: 17,086,925 Number of sequences in database: 5966 Lambda K H 0.321 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,548,552 Number of Sequences: 5966 Number of extensions: 39833 Number of successful extensions: 175 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 173 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 175 length of query: 259 length of database: 5,695,641 effective HSP length: 93 effective length of query: 166 effective length of database: 5,140,803 effective search space: 853373298 effective search space used: 853373298 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 57 (26.6 bits)