TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SelTryp; hypothetical protein [Trypanosoma brucei TREU927] PARTIALLY FROM XP_844760.1 (259 letters) Database: genome.fa 23,491 sequences; 86,045,674 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAXJ01000008.1| Perkinsus marinus ATCC 50983 strain ATCC 5098... 31 1.8 gb|AAXJ01000631.1| Perkinsus marinus ATCC 50983 strain ATCC 5098... 30 3.2 gb|AAXJ01003719.1| Perkinsus marinus ATCC 50983 strain ATCC 5098... 29 7.0 gb|AAXJ01002350.1| Perkinsus marinus ATCC 50983 strain ATCC 5098... 29 7.0 gb|AAXJ01001401.1| Perkinsus marinus ATCC 50983 strain ATCC 5098... 29 9.2 gb|AAXJ01000691.1| Perkinsus marinus ATCC 50983 strain ATCC 5098... 29 9.2 >gb|AAXJ01000008.1| Perkinsus marinus ATCC 50983 strain ATCC 50983 gcontig_1104296784056, whole genome shotgun sequence Length = 143789 Score = 31.2 bits (69), Expect = 1.8 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +2 Query: 214 GAFEVYLNGSLIYSKLETGAVPTAETLADHILRQIISGTAAGTR 257 GAFE+Y +LI+S L+ G +P + +R + T A TR Sbjct: 1667 GAFEIYKGNTLIWSTLQAGRLPKLNDIVAVRIRSLSLRTHALTR 1798 >gb|AAXJ01000631.1| Perkinsus marinus ATCC 50983 strain ATCC 50983 gcontig_1104296587400, whole genome shotgun sequence Length = 23083 Score = 30.4 bits (67), Expect = 3.2 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = -1 Query: 58 HEKGEAFHHLRSKRELILAVLKLEKREEALRKARVTDTVQ 97 H GE+FHH+RS + L +L + A RKAR+ +TV+ Sbjct: 12763 HGSGESFHHVRSTQRL----GELL*SDAATRKARLDETVR 12656 >gb|AAXJ01003719.1| Perkinsus marinus ATCC 50983 strain ATCC 50983 gcontig_1104296647972, whole genome shotgun sequence Length = 4124 Score = 29.3 bits (64), Expect = 7.0 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = -3 Query: 150 GAFREFIGNILSTGFLASIAISFFAPFLRGALPP---HIAEWIEQHR 193 G R+F +T +L S+A FL +PP H +W QH+ Sbjct: 3078 GMIRQFDSRTTTTTYLLSVARVISTEFLSVLVPPTLSHYTKWATQHK 2938 >gb|AAXJ01002350.1| Perkinsus marinus ATCC 50983 strain ATCC 50983 gcontig_1104296295170, whole genome shotgun sequence Length = 6502 Score = 29.3 bits (64), Expect = 7.0 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +3 Query: 100 VRVEYCSGXGYRRHYEEVAESLLRSLPPELREQQKGKK 137 +R++ CSG +RR Y++ S L PP R +++ +K Sbjct: 2394 LRIDSCSGRDWRRIYKQGGRSDLP*TPPFWRRKEESRK 2507 >gb|AAXJ01001401.1| Perkinsus marinus ATCC 50983 strain ATCC 50983 gcontig_1104296787694, whole genome shotgun sequence Length = 11405 Score = 28.9 bits (63), Expect = 9.2 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +3 Query: 126 PPELREQQKGKKPFIKFVGVVYSVGAFREFIG 157 PP+LR+ KGKK + G V SVG FR +G Sbjct: 9615 PPQLRKALKGKKSYSGGDGAV-SVGIFRPALG 9707 >gb|AAXJ01000691.1| Perkinsus marinus ATCC 50983 strain ATCC 50983 gcontig_1104296615540, whole genome shotgun sequence Length = 21094 Score = 28.9 bits (63), Expect = 9.2 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +2 Query: 133 QKGKKPFIKFVGVVYSVGAF-REFIGNILSTGF 164 QKG +K VG+ Y+V AF R + N+L GF Sbjct: 16610 QKGLLSLLKQVGITYAVNAFVRYSVNNMLPEGF 16708 Database: genome.fa Posted date: Jan 16, 2009 12:51 PM Number of letters in database: 86,045,674 Number of sequences in database: 23,491 Lambda K H 0.321 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,180,397 Number of Sequences: 23491 Number of extensions: 258683 Number of successful extensions: 1041 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1000 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1041 length of query: 259 length of database: 28,681,891 effective HSP length: 104 effective length of query: 155 effective length of database: 26,238,827 effective search space: 4067018185 effective search space used: 4067018185 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 63 (28.9 bits)