TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SelTryp; hypothetical protein [Trypanosoma brucei TREU927] PARTIALLY FROM XP_844760.1 (259 letters) Database: genome.fa 14,463 sequences; 46,187,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig_0014473 30 2.9 Contig_0002450 29 5.0 Contig_0011176 28 6.5 Contig_0001453 28 8.5 >Contig_0014473 Length = 2306 Score = 29.6 bits (65), Expect = 2.9 Identities = 14/36 (38%), Positives = 26/36 (72%) Frame = -1 Query: 89 KARVTDTVQHEVRVEYCSGXGYRRHYEEVAESLLRS 124 +A++ TV E+ +++C G GYR +++ AE+L+RS Sbjct: 1112 RAKMARTV--EITIQFCGG*GYRPYFDR-AEALIRS 1014 >Contig_0002450 Length = 8564 Score = 28.9 bits (63), Expect = 5.0 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 7/61 (11%) Frame = +3 Query: 54 KQMLHEKGEAFHHLRSKRELILAVLKLEKR-------EEALRKARVTDTVQHEVRVEYCS 106 +Q HE+G+ + R +R + A K KR EEA R RV+ + + V V C Sbjct: 6717 RQQTHERGQ--RNARLRRRGLHAATKERKRRGGGEAVEEAXRAGRVSRSAKRRVMVLLCQ 6890 Query: 107 G 107 G Sbjct: 6891 G 6893 >Contig_0011176 Length = 2961 Score = 28.5 bits (62), Expect = 6.5 Identities = 27/87 (31%), Positives = 42/87 (48%), Gaps = 1/87 (1%) Frame = -3 Query: 49 KEADLKQMLHEKGEAFHHLRSKRELILAVLKLEKREEALRKARVTDTVQHEVRVEYCSGX 108 K ++K+ +HEK E + KRE K KREE +K + + + +E Sbjct: 631 KMEEMKEKMHEKKEKRTEKKGKRE-----EKKGKREE--KKGKNAEKREKTDEMEGEQES 473 Query: 109 GYRRHYEEVAES-LLRSLPPELREQQK 134 G +R+ + +E L R P E REQ+K Sbjct: 472 GRQRYLKGQSEKRLWRVSPLEDREQEK 392 >Contig_0001453 Length = 6815 Score = 28.1 bits (61), Expect = 8.5 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = -2 Query: 53 LKQMLHEKGEAFHHLRSKRELILAVLKLEKREEALRKA 90 L L+++GE H+LR+ R+L A L+ +K R+A Sbjct: 4855 LPDALNQRGETPHYLRTGRKLASANLQRQKEPPVQRRA 4742 Database: genome.fa Posted date: Jan 16, 2009 12:51 PM Number of letters in database: 46,187,198 Number of sequences in database: 14,463 Lambda K H 0.321 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,081,089 Number of Sequences: 14463 Number of extensions: 151669 Number of successful extensions: 866 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 849 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 865 length of query: 259 length of database: 15,395,732 effective HSP length: 100 effective length of query: 159 effective length of database: 13,949,432 effective search space: 2217959688 effective search space used: 2217959688 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 61 (28.1 bits)