TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SelTryp; hypothetical protein [Trypanosoma brucei TREU927] PARTIALLY FROM XP_844760.1 (259 letters) Database: genome.fa 1696 sequences; 31,706,682 total letters Searching...................................................done Score E Sequences producing significant alignments: (bits) Value mex318i07.p1k 108 3e-24 mex457p19.q1k 64 8e-11 mex251d04.q1k 35 0.053 mex28h19.p1k 29 3.8 mex590l18.q1k 28 6.4 mex124k21.q1k 28 8.4 >mex318i07.p1k Length = 75510 Score = 108 bits (271), Expect = 3e-24 Identities = 58/152 (38%), Positives = 89/152 (58%) Frame = +3 Query: 98 HEVRVEYCSGXGYRRHYEEVAESLLRSLPPELREQQKGKKPFIKFVGVVYSVGAFREFIG 157 HE++V YC+G GY +++E++ + L R LP ++ VG Y R Sbjct: 24 HELKVLYCTG*GYAKYFEDMKQQLQRLLPNAQE---------VRIVGGTYPTPPARALAA 176 Query: 158 NILSTGFLASIAISFFAPFLRGALPPHIAEWIEQHRGMVVGAGFMMNMVASSLLQSGAFE 217 + ST FL S+ ++ L LPP + +I Q RGM++GAGF++NMV +L Q+GAFE Sbjct: 177 KVCSTAFLTSLGVALAGQQL-AFLPPTVLNFIAQQRGMLIGAGFLLNMVGGALGQTGAFE 353 Query: 218 VYLNGSLIYSKLETGAVPTAETLADHILRQII 249 V L+G LI+SKL+ GAVPT + +L++ + Sbjct: 354 VSLDGELIFSKLQAGAVPTVAEIRRIVLQKTL 449 >mex457p19.q1k Length = 1946 Score = 64.3 bits (155), Expect = 8e-11 Identities = 37/109 (33%), Positives = 62/109 (56%), Gaps = 2/109 (1%) Frame = -2 Query: 153 REFIGNILSTGFLASIAISFFAPFLRGALPPHIAEWIEQHRGMVVGAGFMMNMVASSLLQ 212 R I L F ++ ++ L+ +P + + RG++ GFM+N+++ + LQ Sbjct: 1945 RVLISKALQGAFFGTLGLALLGDQLK-FIPESVLAVLRARRGLITSTGFMLNVLSRAALQ 1769 Query: 213 SGAFEVYLNGSLIYSKLE-TGAVPTAETLADHILRQ-IISGTAAGTRTA 259 + AFEV+L+G LIYS L +G VPTA L++ +L Q ++ A T+TA Sbjct: 1768 NSAFEVFLDGKLIYSALNASGRVPTAALLSNLLLEQTLLKDYYAATKTA 1622 Score = 48.1 bits (113), Expect = 6e-06 Identities = 25/56 (44%), Positives = 37/56 (66%), Gaps = 3/56 (5%) Frame = -2 Query: 34 ATDYSSHRYKYLEMLKEADLKQMLHEKGEA---FHHLRSKRELILAVLKLEKREEA 86 A ++S Y YL+ML E DL+QML+EK R+K+EL+ AV ++E+RE+A Sbjct: 379 AVEHSKDPYAYLDMLDEVDLQQMLYEKTHGQVQVSAFRNKKELVAAVRQIEEREDA 212 >mex251d04.q1k Length = 233342 Score = 35.0 bits (79), Expect = 0.053 Identities = 34/132 (25%), Positives = 51/132 (38%) Frame = -2 Query: 55 QMLHEKGEAFHHLRSKRELILAVLKLEKREEALRKARVTDTVQHEVRVEYCSGXGYRRHY 114 Q LHE+G H S + I ++K ++ E +R H+ + + C+G G ++ Sbjct: 135253 QPLHEEGR--HPFPSTSKKIKKIVKTPRKNENKEPSR---NKTHQKKRQMCAGEGEQKRA 135089 Query: 115 EEVAESLLRSLPPELREQQKGKKPFIKFVGVVYSVGAFREFIGNILSTGFLASIAISFFA 174 R E +K K+PF FV V S + ASI FF+ Sbjct: 135088 RRWRSRRGREGGAEAEAGEKNKRPFCPFVPSVPSPASSS------------ASIPSFFFS 134945 Query: 175 PFLRGALPPHIA 186 R PH A Sbjct: 134944 RHSRARRKPHAA 134909 >mex28h19.p1k Length = 50963 Score = 28.9 bits (63), Expect = 3.8 Identities = 23/77 (29%), Positives = 34/77 (44%) Frame = +3 Query: 73 LILAVLKLEKREEALRKARVTDTVQHEVRVEYCSGXGYRRHYEEVAESLLRSLPPELREQ 132 L+LAVL + + + VQHEV +YC G RH + E LLR P Sbjct: 39696 LVLAVLHVNPQPNPAER----HCVQHEVDAQYCRGEWRDRH---IWEGLLRD--PLRVGI 39848 Query: 133 QKGKKPFIKFVGVVYSV 149 + ++ G+ Y+V Sbjct: 39849 ESSSASLLRLHGIPYAV 39899 >mex590l18.q1k Length = 8211 Score = 28.1 bits (61), Expect = 6.4 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = +3 Query: 164 FLASIAISFFAPFLRGALPPHI 185 FLA + SFF F RGALPPH+ Sbjct: 3852 FLACLFFSFF--FGRGALPPHL 3911 >mex124k21.q1k Length = 3256 Score = 27.7 bits (60), Expect = 8.4 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +3 Query: 90 ARVTDTVQHEVRVEYCSGXGYRRHYEEVA 118 AR VQHEV V + SG RRH E A Sbjct: 846 ARHRGDVQHEVGVAHASGDVRRRHLEVAA 932 Database: genome.fa Posted date: Jan 16, 2009 12:51 PM Number of letters in database: 31,706,682 Number of sequences in database: 1696 Lambda K H 0.321 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,418,070 Number of Sequences: 1696 Number of extensions: 119835 Number of successful extensions: 728 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 118 Number of HSP's successfully gapped in prelim test: 32 Number of HSP's that attempted gapping in prelim test: 591 Number of HSP's gapped (non-prelim): 221 length of query: 259 length of database: 10,568,894 effective HSP length: 98 effective length of query: 161 effective length of database: 10,402,686 effective search space: 1674832446 effective search space used: 1674832446 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 59 (27.3 bits)