TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SelTryp; hypothetical protein [Trypanosoma brucei TREU927] PARTIALLY FROM XP_844760.1 (259 letters) Database: genome.fa 6902 sequences; 42,263,565 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AANW02000166.1| Entamoeba invadens IP1 gcontig_1105074713641,... 28 8.2 gb|AANW02000006.1| Entamoeba invadens IP1 gcontig_1105074720924,... 28 8.2 >gb|AANW02000166.1| Entamoeba invadens IP1 gcontig_1105074713641, whole genome shotgun sequence Length = 37095 Score = 28.1 bits (61), Expect = 8.2 Identities = 11/21 (52%), Positives = 18/21 (85%), Gaps = 1/21 (4%) Frame = +2 Query: 128 ELREQQKG-KKPFIKFVGVVY 147 E+REQQ G ++PF+KFV +++ Sbjct: 33845 EVREQQNGLQEPFVKFVSIIH 33907 >gb|AANW02000006.1| Entamoeba invadens IP1 gcontig_1105074720924, whole genome shotgun sequence Length = 146342 Score = 28.1 bits (61), Expect = 8.2 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 2/66 (3%) Frame = -1 Query: 41 RYKYLEMLKEADLKQMLHEKGEAFHHLRSKRELILAVLKLEKREEALR--KARVTDTVQH 98 RY+ M E ++K+ML +K + + + + LKL K+E+ R K R+ + Sbjct: 55913 RYESYSMRDEHEIKEMLKQKKVSLSGVHRILKRLGVTLKLVKKEQFNRNVKVRIEQRKMY 55734 Query: 99 EVRVEY 104 +EY Sbjct: 55733 ADHIEY 55716 Database: genome.fa Posted date: Jan 16, 2009 12:51 PM Number of letters in database: 42,263,565 Number of sequences in database: 6902 Lambda K H 0.321 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,350,211 Number of Sequences: 6902 Number of extensions: 91859 Number of successful extensions: 369 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 266 Number of HSP's successfully gapped in prelim test: 12 Number of HSP's that attempted gapping in prelim test: 91 Number of HSP's gapped (non-prelim): 297 length of query: 259 length of database: 14,087,855 effective HSP length: 100 effective length of query: 159 effective length of database: 13,397,655 effective search space: 2130227145 effective search space used: 2130227145 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 60 (27.7 bits)