TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SelTryp; hypothetical protein [Trypanosoma brucei TREU927] PARTIALLY FROM XP_844760.1 (259 letters) Database: genome.fa 4707 sequences; 47,745,626 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pathogen_EIMER_contig_00029452 - eimerbac20h5Be10.p1ka low_quali... 35 0.10 pathogen_EIMER_contig_00031144 - eimer-912d02.q1ka low_quality_r... 30 3.2 pathogen_EIMER_contig_00021084 - eimer-1157a06.q1k low_quality_r... 29 5.5 >pathogen_EIMER_contig_00029452 - eimerbac20h5Be10.p1ka low_quality_removed Length = 42137 Score = 34.7 bits (78), Expect = 0.10 Identities = 20/42 (47%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = +1 Query: 190 EQHRGMVVGAGFMMNMVASS-LLQSGAFEVYLNGSLIYSKLE 230 E +R ++V A F+ V SS LLQ+GAFE+Y LI+S L+ Sbjct: 37837 EANRLLLVAAVFVAAAVCSSFLLQTGAFEIYYERDLIWSALD 37962 >pathogen_EIMER_contig_00031144 - eimer-912d02.q1ka low_quality_removed Length = 2732 Score = 29.6 bits (65), Expect = 3.2 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +2 Query: 83 REEALRKARVTDTVQHEVRVEYCSGXGYRRHYEEVAESLLRSLPP 127 RE + R T++ HE+ C G G + H ++ LRS P Sbjct: 140 RERRSGRGRRTESPNHELGFRVCRGRGLQEHSTHISPFSLRSRSP 274 >pathogen_EIMER_contig_00021084 - eimer-1157a06.q1k low_quality_removed Length = 156826 Score = 28.9 bits (63), Expect = 5.5 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 1/77 (1%) Frame = -3 Query: 62 EAFHHLRSKR-ELILAVLKLEKREEALRKARVTDTVQHEVRVEYCSGXGYRRHYEEVAES 120 E + + KR +L LA +LEK++ LR AR QH R+Y EV E Sbjct: 64886 EVYRDVEPKRLKLRLAEEELEKKQTDLRLARGRSAQQHACARHQLRARAKCRNYVEVWEF 64707 Query: 121 LLRSLPPELREQQKGKK 137 L R + R ++ K+ Sbjct: 64706 LCRLEDIQKRLEELNKQ 64656 Score = 28.5 bits (62), Expect = 7.2 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = -1 Query: 160 LSTGFLASIAISFFAPFLRGALPPHIAEWIEQHRGMVVGAGFMMNM 205 L TG L SIA PF + + PP + H +VG G + M Sbjct: 113782 LVTGVLRSIAFCTIGPFQKVSFPPRVT---AAHSAFLVGVGEIAKM 113654 Database: genome.fa Posted date: Jan 16, 2009 12:51 PM Number of letters in database: 47,745,626 Number of sequences in database: 4707 Lambda K H 0.321 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,732,891 Number of Sequences: 4707 Number of extensions: 139002 Number of successful extensions: 703 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 297 Number of HSP's successfully gapped in prelim test: 39 Number of HSP's that attempted gapping in prelim test: 352 Number of HSP's gapped (non-prelim): 436 length of query: 259 length of database: 15,915,208 effective HSP length: 101 effective length of query: 158 effective length of database: 15,439,801 effective search space: 2439488558 effective search space used: 2439488558 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 61 (28.1 bits)