TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000003_1.0 # Protein # Iodothyronine deiodinase 3 (DI3) # Homo sapiens # Complete (278 letters) Database: genome.fa 14,463 sequences; 46,187,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Contig_0009131 31 1.5 Contig_0002444 30 1.9 Contig_0007933 29 4.3 Contig_0002091 29 4.3 Contig_0005344 24 4.4 Contig_0010964 29 5.6 Contig_0013210 28 7.3 Contig_0001206 28 7.3 Contig_0000309 28 7.3 Contig_0007634 28 9.5 Contig_0008396 28 9.5 Contig_0004581 28 9.5 >Contig_0009131 Length = 1704 Score = 30.8 bits (68), Expect = 1.5 Identities = 15/54 (27%), Positives = 23/54 (42%) Frame = +2 Query: 83 CTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVVLPDGFQSQHILDYAQGNRPLV 136 C+L S + W G++ ++ E GP V P G S +G +P V Sbjct: 419 CSLGSWRMAWRGRR*TEIREMREIGPTNGGRVNSPLGSASSRFTSIRRGRKPWV 580 >Contig_0002444 Length = 5299 Score = 30.4 bits (67), Expect = 1.9 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 5/37 (13%) Frame = -2 Query: 45 FLGRRRRGQPEPEVELNSEGEEVPPD-----DPPICV 76 F G+ + GQPEPE + EV PD P +CV Sbjct: 3837 FCGKTQVGQPEPEKPFSGAENEVKPD*SLRKSPEVCV 3727 >Contig_0007933 Length = 5716 Score = 29.3 bits (64), Expect = 4.3 Identities = 16/54 (29%), Positives = 24/54 (44%) Frame = +3 Query: 17 ASCLVLFPRFLGTAFMLWLLDFLCIRKHFLGRRRRGQPEPEVELNSEGEEVPPD 70 A+C + FLG+ + ++ H + R RG + ELN E PPD Sbjct: 4143 ATCAGVAAHFLGSFLVGCAATSFGLQNHLVSRALRGDVIHDAELNRASEAHPPD 4304 >Contig_0002091 Length = 15069 Score = 29.3 bits (64), Expect = 4.3 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = -3 Query: 72 PPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVV 115 PP+C++ +R C++ WH + + GGP P VV Sbjct: 2383 PPLCITGTDRGCSITFCNFSWHCRYPPALRCEVCGGPVPAPTVV 2252 >Contig_0005344 Length = 5864 Score = 23.9 bits (50), Expect(2) = 4.4 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 63 EGEEVPPDDPPICVSDDNRLCTLAS 87 E + P PPI S +CTLAS Sbjct: 4564 EVPDTPCSGPPIQTSTRQNMCTLAS 4490 Score = 23.5 bits (49), Expect(2) = 4.4 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = -1 Query: 37 DFLCIRKHFLGRRRRG 52 ++ CIR+ +GR+RRG Sbjct: 4610 EYACIRERPVGRKRRG 4563 >Contig_0010964 Length = 3411 Score = 28.9 bits (63), Expect = 5.6 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +1 Query: 38 FLCIRKHFLGRRRRGQPEPEVELNSEGEEVPPDDP 72 F C+R+H R R Q + + GEE P P Sbjct: 184 FACLRRHAFARTRARQTSRPIPRETRGEETPAATP 288 >Contig_0013210 Length = 1142 Score = 28.5 bits (62), Expect = 7.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 38 FLCIRKHFLGRRRRGQP 54 FLC+ HFLGR R+G P Sbjct: 106 FLCVCGHFLGRGRQGPP 156 >Contig_0001206 Length = 8661 Score = 28.5 bits (62), Expect = 7.3 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = -3 Query: 88 LKAVWHGQKLDFFKQAHEGGPAPNSEVVLPDGFQSQHILD 127 L+ WH Q LD + GPA V P GF +D Sbjct: 7612 LRGPWHDQTLDHLSTSSAAGPAVFLHRVYPPGFPQTWNMD 7493 >Contig_0000309 Length = 6337 Score = 28.5 bits (62), Expect = 7.3 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 5/34 (14%) Frame = -1 Query: 38 FLCIRKHFLGRRRRGQP-----EPEVELNSEGEE 66 F C +KH L R G+P +P V N GEE Sbjct: 3250 FSCTKKHILHTTRSGKPF*PHLDPNVRTNRSGEE 3149 >Contig_0007634 Length = 5707 Score = 28.1 bits (61), Expect = 9.5 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 6/40 (15%) Frame = -2 Query: 18 SCLVLFPRFLGTAFMLWLLDFLCI------RKHFLGRRRR 51 +CL +F FL F+ FLC+ R FLG+RRR Sbjct: 5370 ACLFIFLFFLFVLFLFLARAFLCVVVVLSRRTAFLGQRRR 5251 >Contig_0008396 Length = 10608 Score = 28.1 bits (61), Expect = 9.5 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +1 Query: 110 PNSEVVLPDGFQSQHILDYAQGNRPLVLNFGSCTXPPFMARMS 152 P+ +V PDG + + +R L L+F SC+ PF R+S Sbjct: 8329 PSCDVTRPDGGRQNELSKNDACSRQLRLSFLSCSLFPFSFRVS 8457 >Contig_0004581 Length = 5215 Score = 28.1 bits (61), Expect = 9.5 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = -1 Query: 48 RRRRGQPEPEVELNSEGEEV----PPDDPPICVSDDNRLCTLAS 87 +R RG+PEP +G++ P D P +C+ LC+ S Sbjct: 3178 QRARGRPEPISAPGGDGKKRRKCRPSDVPEVCLCRSESLCSFVS 3047 Database: genome.fa Posted date: Jan 16, 2009 12:51 PM Number of letters in database: 46,187,198 Number of sequences in database: 14,463 Lambda K H 0.322 0.139 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,198,812 Number of Sequences: 14463 Number of extensions: 401885 Number of successful extensions: 2230 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2171 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2229 length of query: 278 length of database: 15,395,732 effective HSP length: 101 effective length of query: 177 effective length of database: 13,934,969 effective search space: 2466489513 effective search space used: 2466489513 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 61 (28.1 bits)