TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000001_1.0 # Protein # Iodothyronine deiodinase 1 (DI1) # Homo sapiens # Complete (249 letters) Database: genome.fa 23,491 sequences; 86,045,674 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAXJ01000256.1| Perkinsus marinus ATCC 50983 strain ATCC 5098... 30 3.9 gb|AAXJ01000448.1| Perkinsus marinus ATCC 50983 strain ATCC 5098... 29 6.6 gb|AAXJ01000318.1| Perkinsus marinus ATCC 50983 strain ATCC 5098... 29 6.6 >gb|AAXJ01000256.1| Perkinsus marinus ATCC 50983 strain ATCC 50983 gcontig_1104296734694, whole genome shotgun sequence Length = 40653 Score = 30.0 bits (66), Expect = 3.9 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = -3 Query: 85 TTELGGLAPNCPVVRLSGQRCNIWEFMQGNRPLVLNFGSCTXPS 128 +T GGL P+CPV+R+ Q ++ R +V N G+ + P+ Sbjct: 18229 STSCGGLNPSCPVLRIFSQCIVAFDLHGMLRDVVANNGTPSDPT 18098 >gb|AAXJ01000448.1| Perkinsus marinus ATCC 50983 strain ATCC 50983 gcontig_1104296756580, whole genome shotgun sequence Length = 29019 Score = 29.3 bits (64), Expect = 6.6 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = -1 Query: 64 TFFSTQYFWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQRCN 106 T F+ F+ V + E+ EL P+ P+V LSG RC+ Sbjct: 18135 TMFAANMLNFLTHVHSKGPEEVQELFTAGPSRPIVLLSGSRCS 18007 >gb|AAXJ01000318.1| Perkinsus marinus ATCC 50983 strain ATCC 50983 gcontig_1104296762408, whole genome shotgun sequence Length = 35466 Score = 29.3 bits (64), Expect = 6.6 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 66 FSTQYFWFVLKVRWQRLEDTT 86 ++ Q+FW+ L +RW R DTT Sbjct: 6840 WNAQWFWWYLSLRWLRTADTT 6778 Database: genome.fa Posted date: Jan 16, 2009 12:51 PM Number of letters in database: 86,045,674 Number of sequences in database: 23,491 Lambda K H 0.324 0.138 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,240,660 Number of Sequences: 23491 Number of extensions: 368932 Number of successful extensions: 1830 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1721 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1830 length of query: 249 length of database: 28,681,891 effective HSP length: 104 effective length of query: 145 effective length of database: 26,238,827 effective search space: 3804629915 effective search space used: 3804629915 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 63 (28.9 bits)