TBLASTN 2.2.13 [Nov-27-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= SelTryp; hypothetical protein [Trypanosoma brucei TREU927]
PARTIALLY FROM XP_844760.1
         (259 letters)

Database: genome.fa 
           8 sequences; 8,358,125 total letters

Searching........done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

emb|CR940347.1| Theileria annulata strain Ankara isolate clone C...    26   6.9  

>emb|CR940347.1| Theileria annulata strain Ankara isolate clone C9, *** SEQUENCING IN
              PROGRESS ***
          Length = 2592520

 Score = 26.2 bits (56), Expect = 6.9
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = +1

Query: 125    LPPELREQQKGKKPFIKFVGVVYSVGAFREFIG 157
              +P E +  QK     IK + +VY +  F E+IG
Sbjct: 867205 IPKEYQVNQKVLVFIIKIIQIVYIISMFLEYIG 867303


  Database: genome.fa
    Posted date:  Jan 19, 2010  5:09 PM
  Number of letters in database: 8,358,125
  Number of sequences in database:  8
  
Lambda     K      H
   0.321    0.136    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,740,357
Number of Sequences: 8
Number of extensions: 20375
Number of successful extensions: 80
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 75
Number of HSP's gapped (non-prelim): 11
length of query: 259
length of database: 2,786,041
effective HSP length: 89
effective length of query: 170
effective length of database: 2,785,329
effective search space: 473505930
effective search space used: 473505930
frameshift window, decay const: 40,  0.1
T: 13
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 55 (25.8 bits)