TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SelTryp; hypothetical protein [Trypanosoma brucei TREU927] PARTIALLY FROM XP_844760.1 (259 letters) Database: genome.fa 572 sequences; 14,903,514 total letters Searching...................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAQX01000139.1| Phytophthora ramorum strain Pr102 Pramorum_Co... 32 0.17 gb|AAQX01000489.1| Phytophthora ramorum strain Pr102 Pramorum_Co... 31 0.37 gb|AAQX01000560.1| Phytophthora ramorum strain Pr102 Pramorum_Co... 27 5.4 gb|AAQX01000552.1| Phytophthora ramorum strain Pr102 Pramorum_Co... 27 9.1 gb|AAQX01000143.1| Phytophthora ramorum strain Pr102 Pramorum_Co... 27 9.1 >gb|AAQX01000139.1| Phytophthora ramorum strain Pr102 Pramorum_Cont139, whole genome shotgun sequence Length = 58346 Score = 32.3 bits (72), Expect = 0.17 Identities = 28/68 (41%), Positives = 38/68 (55%) Frame = +3 Query: 192 HRGMVVGAGFMMNMVASSLLQSGAFEVYLNGSLIYSKLETGAVPTAETLADHILRQIISG 251 H VV A ++ ++AS+L QSG+ V L G S L GAV L+ HI Q I+G Sbjct: 53310 HSTQVVDA--VVALIASALEQSGSGVVALGGVAGSSTLADGAV---TILSGHIAIQ-IAG 53471 Query: 252 TAAGTRTA 259 A+G+R A Sbjct: 53472 AASGSRAA 53495 >gb|AAQX01000489.1| Phytophthora ramorum strain Pr102 Pramorum_Cont489, whole genome shotgun sequence Length = 83904 Score = 31.2 bits (69), Expect = 0.37 Identities = 31/149 (20%), Positives = 64/149 (42%) Frame = -2 Query: 49 KEADLKQMLHEKGEAFHHLRSKRELILAVLKLEKREEALRKARVTDTVQHEVRVEYCSGU 108 K+ +L++M + EA L K+E L++ A+ + + DT+ + ++ + Sbjct: 74783 KKENLERMNQKLAEANAVLSQKQE----ELRVVNENVAMLEKQCKDTLDEKDKLANDAAV 74616 Query: 109 GYRRHYEEVAESLLRSLPPELREQQKGKKPFIKFVGVVYSVGAFREFIGNILSTGFLASI 168 +R AE L+ L E ++ SV + E + ++ FLA+ Sbjct: 74615 TEKRLVR--AEKLISGLSVEGARWKE-------------SVASLAESVLALIGDTFLAAA 74481 Query: 169 AISFFAPFLRGALPPHIAEWIEQHRGMVV 197 IS++ PF G + +W+ Q + + + Sbjct: 74480 CISYYGPFTGGFRQRIVDQWVTQTQALAI 74394 >gb|AAQX01000560.1| Phytophthora ramorum strain Pr102 Pramorum_Cont560, whole genome shotgun sequence Length = 84783 Score = 27.3 bits (59), Expect = 5.4 Identities = 24/84 (28%), Positives = 38/84 (45%), Gaps = 6/84 (7%) Frame = -1 Query: 97 QHEVRVEYCS--GUGYRR---HYEEVAESLLRSLPPELREQQKGKKPFIKFV-GVVYSVG 150 ++E R +C G G++R H + + + S ELR + PFI FV G V S Sbjct: 72144 RYECRCSHCGEIGCGHQRVCAHVDNYSVEVQYSPQEELRPSAQALAPFICFVGGFVNSFH 71965 Query: 151 AFREFIGNILSTGFLASIAISFFA 174 A R + ++L ++ F A Sbjct: 71964 AKRSGVFSVLGNNNNVNVFYFFTA 71893 >gb|AAQX01000552.1| Phytophthora ramorum strain Pr102 Pramorum_Cont552, whole genome shotgun sequence Length = 199956 Score = 26.6 bits (57), Expect = 9.1 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 7/76 (9%) Frame = +3 Query: 66 HLRSKRELILAVLKLEKREEALRKARVTDTVQH-------EVRVEYCSGUGYRRHYEEVA 118 H+R+K++ L V +LE+R L + VQH ++ VE S + +++ + Sbjct: 22290 HIRAKQDTRLRVTELEERSRTLVLFLLAVNVQHRNIDVVQQLTVELDSTARRKENHDLLL 22469 Query: 119 ESLLRSLPPELREQQK 134 + LL E REQQ+ Sbjct: 22470 QVLL-----EEREQQQ 22502 >gb|AAQX01000143.1| Phytophthora ramorum strain Pr102 Pramorum_Cont143, whole genome shotgun sequence Length = 149902 Score = 26.6 bits (57), Expect = 9.1 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +1 Query: 159 ILSTGFLASIAISFFAPFLRGALPPHIAEW 188 +LST FLA+ PFLR PP I W Sbjct: 140965 VLSTAFLAT-------PFLRWRAPPSIGMW 141033 Database: genome.fa Posted date: Jan 19, 2010 5:07 PM Number of letters in database: 14,903,514 Number of sequences in database: 572 Lambda K H 0.321 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,508,947 Number of Sequences: 572 Number of extensions: 46389 Number of successful extensions: 288 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 17 Number of HSP's that attempted gapping in prelim test: 239 Number of HSP's gapped (non-prelim): 99 length of query: 259 length of database: 4,967,838 effective HSP length: 93 effective length of query: 166 effective length of database: 4,914,642 effective search space: 815830572 effective search space used: 815830572 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 57 (26.6 bits)