TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SelTryp; hypothetical protein [Trypanosoma brucei TREU927] PARTIALLY FROM XP_844760.1 (259 letters) Database: genome.fa 218 sequences; 41,633,360 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value scaffold_10 32 0.45 scaffold_7 29 3.8 scaffold_4 28 8.5 >scaffold_10 Length = 1258938 Score = 32.3 bits (72), Expect = 0.45 Identities = 15/23 (65%), Positives = 17/23 (73%) Frame = -3 Query: 213 SGAFEVYLNGSLIYSKLETGAVP 235 SGAFEV +NG LI+SK E G P Sbjct: 782818 SGAFEVVVNGKLIHSKKERGNFP 782750 >scaffold_7 Length = 1435906 Score = 29.3 bits (64), Expect = 3.8 Identities = 12/23 (52%), Positives = 19/23 (82%) Frame = +2 Query: 201 FMMNMVASSLLQSGAFEVYLNGS 223 F+ + VA +LL +GAFE+Y++GS Sbjct: 784277 FVGSTVAQNLLTTGAFEIYVDGS 784345 Score = 28.9 bits (63), Expect = 5.0 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 2/60 (3%) Frame = +1 Query: 127 PELREQQKGKKPFIKFVGVVYSVGAFRE--FIGNILSTGFLASIAISFFAPFLRGALPPH 184 P LR+ + KPF +G ++ VG+FR FI + + + FF P LR H Sbjct: 469147 PRLRQHHE-TKPFQPLIGSLFVVGSFRAAWFINSARCQAGVGYWNLQFFIPCLRNVKHRH 469323 >scaffold_4 Length = 2081438 Score = 28.1 bits (61), Expect = 8.5 Identities = 20/57 (35%), Positives = 34/57 (59%), Gaps = 9/57 (15%) Frame = +3 Query: 45 LEMLKEA-------DLKQMLHEKGEAFHHLRSKRELILAVLKLEK--REEALRKARV 92 LE+ +EA DLK+ + + G ++ + K+ELI A+LK +K +EAL + +V Sbjct: 315732 LELTQEALSAVSVKDLKKEMQKYGISYAGMSEKQELIQALLKHKK*SPQEALARPKV 315902 Database: genome.fa Posted date: Jan 19, 2010 5:06 PM Number of letters in database: 41,633,360 Number of sequences in database: 218 Lambda K H 0.321 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,712,907 Number of Sequences: 218 Number of extensions: 127245 Number of successful extensions: 604 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 9 Number of HSP's that attempted gapping in prelim test: 518 Number of HSP's gapped (non-prelim): 212 length of query: 259 length of database: 13,877,786 effective HSP length: 100 effective length of query: 159 effective length of database: 13,855,986 effective search space: 2203101774 effective search space used: 2203101774 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 60 (27.7 bits)