TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000003_1.0 # Protein # Iodothyronine deiodinase 3 (DI3) # Homo sapiens # Complete (278 letters) Database: genome.fa 5578 sequences; 78,051,097 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAQY01001646.1| Phytophthora sojae strain P6497 Psojae_Cont16... 33 0.40 gb|AAQY01000363.1| Phytophthora sojae strain P6497 Psojae_Cont36... 32 1.2 gb|AAQY01000957.1| Phytophthora sojae strain P6497 Psojae_Cont95... 31 2.0 gb|AAQY01000549.1| Phytophthora sojae strain P6497 Psojae_Cont54... 31 2.6 gb|AAQY01001162.1| Phytophthora sojae strain P6497 Psojae_Cont11... 30 4.5 gb|AAQY01000103.1| Phytophthora sojae strain P6497 Psojae_Cont10... 30 5.8 gb|AAQY01000613.1| Phytophthora sojae strain P6497 Psojae_Cont61... 29 7.6 gb|AAQY01001417.1| Phytophthora sojae strain P6497 Psojae_Cont14... 29 9.9 gb|AAQY01000333.1| Phytophthora sojae strain P6497 Psojae_Cont33... 29 9.9 gb|AAQY01000332.1| Phytophthora sojae strain P6497 Psojae_Cont33... 29 9.9 >gb|AAQY01001646.1| Phytophthora sojae strain P6497 Psojae_Cont1646, whole genome shotgun sequence Length = 112648 Score = 33.5 bits (75), Expect = 0.40 Identities = 21/69 (30%), Positives = 33/69 (47%) Frame = -3 Query: 33 LWLLDFLCIRKHFLGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASLKAVW 92 LWL+ + C++ +F R GQ E +L P +C S + C + ++ A W Sbjct: 58313 LWLIPYYCLQINFSALR--GQQCVEAKL--------PSRLLLCKSTSSLHCLILTVSAPW 58164 Query: 93 HGQKLDFFK 101 H LD+FK Sbjct: 58163 HCL*LDYFK 58137 >gb|AAQY01000363.1| Phytophthora sojae strain P6497 Psojae_Cont363, whole genome shotgun sequence Length = 84882 Score = 32.0 bits (71), Expect = 1.2 Identities = 19/60 (31%), Positives = 25/60 (41%) Frame = +2 Query: 107 GPAPNSEVVLPDGFQSQHILDYAQGNRPLVLNFGSCTUPPFMARMSAFQRLVTKYQRDVD 166 GPAP+ PD F Q +D P+ N+ SC F M+ V Y R +D Sbjct: 23759 GPAPHCRAGSPDYFPPQTWIDIVTRVGPIYGNYNSCGDLIFSGHMAYTNSAVLLYLRTLD 23938 >gb|AAQY01000957.1| Phytophthora sojae strain P6497 Psojae_Cont957, whole genome shotgun sequence Length = 295306 Score = 31.2 bits (69), Expect = 2.0 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 4/71 (5%) Frame = +3 Query: 27 LGTAFMLWLLDFLCIRKHFLGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLA 86 L A+ + + D C + +GRRRR + + EG PP + ++ N+ CT A Sbjct: 263130 LRVAYQIHI*DASCRK---IGRRRRRRDDCHSHRVPEGPVSPPALSAVTATNKNKTCTSA 263300 Query: 87 SLK----AVWH 93 S++ A WH Sbjct: 263301 SVQEHVLADWH 263333 >gb|AAQY01000549.1| Phytophthora sojae strain P6497 Psojae_Cont549, whole genome shotgun sequence Length = 157963 Score = 30.8 bits (68), Expect = 2.6 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = -2 Query: 130 QGNRPLVLNFG---SCTUPPFMARMSAFQRLVTKYQR 163 QGNRPLV FG +CT P M R+ +L + +R Sbjct: 43047 QGNRPLVSGFGITCACTLPSAMIRIRRMHKLCSTTRR 42937 >gb|AAQY01001162.1| Phytophthora sojae strain P6497 Psojae_Cont1162, whole genome shotgun sequence Length = 203904 Score = 30.0 bits (66), Expect = 4.5 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = +3 Query: 47 GRRRRGQPEPEVELNSEGEEVPPDDP 72 GRRRR PEPE E ++ EE PP P Sbjct: 76440 GRRRR--PEPEEEPPAQAEETPPPAP 76511 >gb|AAQY01000103.1| Phytophthora sojae strain P6497 Psojae_Cont103, whole genome shotgun sequence Length = 156591 Score = 29.6 bits (65), Expect = 5.8 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 65 EEVPPDDPPICVSDDNRLCTLASLKAVW 92 + + P PP+C SDD RL LA ++ VW Sbjct: 13476 DSMEPSQPPLCWSDDRRLFLLA-VERVW 13556 >gb|AAQY01000613.1| Phytophthora sojae strain P6497 Psojae_Cont613, whole genome shotgun sequence Length = 198989 Score = 29.3 bits (64), Expect = 7.6 Identities = 24/86 (27%), Positives = 37/86 (43%), Gaps = 9/86 (10%) Frame = +2 Query: 106 GGPAPNSEVVLPDGFQSQHILDYAQGNRPLVLNFGSCTUPPF--MARMSAFQRLV----- 158 GG P+ +V DG H++ G R LVL + P + A Q L+ Sbjct: 79892 GGRGPHEQV---DGVAVLHLV---AGQRVLVLQHAAAVDEPLGGHGHLGALQHLLLHVGH 80053 Query: 159 --TKYQRDVDFLIIYIEEAHPSDGWV 182 + RDV+ L + +++AH WV Sbjct: 80054 GPVQLARDVEELAV*VQDAHVDGVWV 80131 >gb|AAQY01001417.1| Phytophthora sojae strain P6497 Psojae_Cont1417, whole genome shotgun sequence Length = 53788 Score = 28.9 bits (63), Expect = 9.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 49 RRRGQPEPEVELNSEGEEVPPDDPPIC 75 R+ G+P+ + S GE VP D P +C Sbjct: 3484 RKAGRPKKPKRVRSRGEVVPEDSPIVC 3564 >gb|AAQY01000333.1| Phytophthora sojae strain P6497 Psojae_Cont333, whole genome shotgun sequence Length = 2287 Score = 28.9 bits (63), Expect = 9.9 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +2 Query: 246 QGGRGPDGYQVSELRTWLERYDEQLHGARPRRV 278 QG RGP QV +R+ + R +Q GAR R V Sbjct: 1565 QGSRGPLSRQVGHVRSCMRRDGQQNWGARARLV 1663 >gb|AAQY01000332.1| Phytophthora sojae strain P6497 Psojae_Cont332, whole genome shotgun sequence Length = 32000 Score = 28.9 bits (63), Expect = 9.9 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +3 Query: 246 QGGRGPDGYQVSELRTWLERYDEQLHGARPRRV 278 QG RGP QV +R+ + R +Q GAR R V Sbjct: 7164 QGSRGPLSRQVGHVRSCMRRDGQQNWGARARLV 7262 Database: genome.fa Posted date: Jan 19, 2010 5:09 PM Number of letters in database: 78,051,097 Number of sequences in database: 5578 Lambda K H 0.322 0.139 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,434,713 Number of Sequences: 5578 Number of extensions: 650068 Number of successful extensions: 2937 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 565 Number of HSP's successfully gapped in prelim test: 135 Number of HSP's that attempted gapping in prelim test: 1869 Number of HSP's gapped (non-prelim): 1695 length of query: 278 length of database: 26,017,032 effective HSP length: 105 effective length of query: 173 effective length of database: 25,431,342 effective search space: 4399622166 effective search space used: 4399622166 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 63 (28.9 bits)