TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000003_1.0 # Protein # Iodothyronine deiodinase 3 (DI3) # Homo sapiens # Complete (278 letters) Database: genome.fa 572 sequences; 14,903,514 total letters Searching...................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAQX01000068.1| Phytophthora ramorum strain Pr102 Pramorum_Co... 30 0.70 gb|AAQX01000552.1| Phytophthora ramorum strain Pr102 Pramorum_Co... 28 4.5 >gb|AAQX01000068.1| Phytophthora ramorum strain Pr102 Pramorum_Cont68, whole genome shotgun sequence Length = 52266 Score = 30.4 bits (67), Expect = 0.70 Identities = 18/60 (30%), Positives = 25/60 (41%) Frame = +1 Query: 107 GPAPNSEVVLPDGFQSQHILDYAQGNRPLVLNFGSCTUPPFMARMSAFQRLVTKYQRDVD 166 GPAP+ PD F + +D P+ N+ SC F M+ V Y R +D Sbjct: 16924 GPAPHCRAGSPDYFPPKTWIDIVTRVGPIYGNYNSCGDLIFSGHMAYTNSAVLLYLRTLD 17103 >gb|AAQX01000552.1| Phytophthora ramorum strain Pr102 Pramorum_Cont552, whole genome shotgun sequence Length = 199956 Score = 27.7 bits (60), Expect = 4.5 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = +1 Query: 192 QHRSLEDRVSAARVLQQGAPGCALVLDTMANSSSSA 227 Q R SA RVLQ+G P AL L ++A S SSA Sbjct: 72604 QRRQEPGSFSAGRVLQRGCPLAAL-LSSIAQSRSSA 72708 Database: genome.fa Posted date: Jan 19, 2010 5:07 PM Number of letters in database: 14,903,514 Number of sequences in database: 572 Lambda K H 0.322 0.139 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,349,583 Number of Sequences: 572 Number of extensions: 121891 Number of successful extensions: 531 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 25 Number of HSP's that attempted gapping in prelim test: 425 Number of HSP's gapped (non-prelim): 209 length of query: 278 length of database: 4,967,838 effective HSP length: 94 effective length of query: 184 effective length of database: 4,914,070 effective search space: 904188880 effective search space used: 904188880 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 57 (26.6 bits)