TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000003_1.0 # Protein # Iodothyronine deiodinase 3 (DI3) # Homo sapiens # Complete (278 letters) Database: genome.fa 306 sequences; 11,192,215 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AACB02000020.1| Giardia lamblia ATCC 50803 strain WB C6 ctg02... 28 3.5 gb|AACB02000015.1| Giardia lamblia ATCC 50803 strain WB C6 ctg02... 28 3.5 gb|AACB02000013.1| Giardia lamblia ATCC 50803 strain WB C6 ctg02... 27 5.9 >gb|AACB02000020.1| Giardia lamblia ATCC 50803 strain WB C6 ctg02_20, whole genome shotgun sequence Length = 187573 Score = 27.7 bits (60), Expect = 3.5 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -3 Query: 44 HFLGRRRRGQPEPEVELNSEGEEVPPDDPP 73 H L + RGQ P L+ EG PP PP Sbjct: 106817 HLLRQAARGQSHPPGLLHPEGCHAPPRPPP 106728 >gb|AACB02000015.1| Giardia lamblia ATCC 50803 strain WB C6 ctg02_15, whole genome shotgun sequence Length = 231239 Score = 27.7 bits (60), Expect = 3.5 Identities = 16/49 (32%), Positives = 28/49 (57%) Frame = -2 Query: 199 RVSAARVLQQGAPGCALVLDTMANSSSSAYGAYFERLYVIQSGTIMYQG 247 R A ++ GAP +L + ++SS A GA+ R +++ TI+Y+G Sbjct: 88750 RCQAQALVASGAPDSSLDSCSCSSSSWPAPGAHTFRKPFLETVTILYEG 88604 >gb|AACB02000013.1| Giardia lamblia ATCC 50803 strain WB C6 ctg02_13, whole genome shotgun sequence Length = 266103 Score = 26.9 bits (58), Expect = 5.9 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +3 Query: 254 YQVSELRTWLERYDEQLHGARP 275 Y S++R+W+ R+ Q+HG P Sbjct: 49143 YNRSDIRSWMRRHIVQVHGLTP 49208 Database: genome.fa Posted date: Jan 19, 2010 5:05 PM Number of letters in database: 11,192,215 Number of sequences in database: 306 Lambda K H 0.322 0.139 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,489,427 Number of Sequences: 306 Number of extensions: 81384 Number of successful extensions: 352 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 13 Number of HSP's that attempted gapping in prelim test: 298 Number of HSP's gapped (non-prelim): 162 length of query: 278 length of database: 3,730,738 effective HSP length: 92 effective length of query: 186 effective length of database: 3,702,586 effective search space: 688680996 effective search space used: 688680996 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 56 (26.2 bits)