TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000001_1.0 # Protein # Iodothyronine deiodinase 1 (DI1) # Homo sapiens # Complete (249 letters) Database: genome.fa 5578 sequences; 78,051,097 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAQY01001663.1| Phytophthora sojae strain P6497 Psojae_Cont16... 30 2.9 gb|AAQY01000549.1| Phytophthora sojae strain P6497 Psojae_Cont54... 30 2.9 >gb|AAQY01001663.1| Phytophthora sojae strain P6497 Psojae_Cont1663, whole genome shotgun sequence Length = 168583 Score = 30.4 bits (67), Expect = 2.9 Identities = 16/54 (29%), Positives = 24/54 (44%) Frame = +2 Query: 55 HFSHDNWIPTFFSTQYFWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQRCNIW 108 HF W+ T +S+ WF +W ++ AP P + LS RC +W Sbjct: 152453 HFCGAGWLATGWSS---WF----KWSHVDPLRAASCPAPGAP*LLLSRPRCRLW 152593 >gb|AAQY01000549.1| Phytophthora sojae strain P6497 Psojae_Cont549, whole genome shotgun sequence Length = 157963 Score = 30.4 bits (67), Expect = 2.9 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = -2 Query: 112 QGNRPLVLNFG---SCTUPSFMFKFDQFKRL 139 QGNRPLV FG +CT PS M + + +L Sbjct: 43047 QGNRPLVSGFGITCACTLPSAMIRIRRMHKL 42955 Database: genome.fa Posted date: Jan 19, 2010 5:09 PM Number of letters in database: 78,051,097 Number of sequences in database: 5578 Lambda K H 0.324 0.138 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,124,494 Number of Sequences: 5578 Number of extensions: 357829 Number of successful extensions: 1882 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 342 Number of HSP's successfully gapped in prelim test: 89 Number of HSP's that attempted gapping in prelim test: 1331 Number of HSP's gapped (non-prelim): 925 length of query: 249 length of database: 26,017,032 effective HSP length: 104 effective length of query: 145 effective length of database: 25,436,920 effective search space: 3688353400 effective search space used: 3688353400 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 62 (28.5 bits)