TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SelJ_tetraodon_nigroviridis (189 letters) Database: genome.fa 99,319 sequences; 85,114,155 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 81528.m00049|Leucine Rich Repeat family protein|1890|Identical t... 32 0.59 81529.m00498|conserved hypothetical protein|894|Identical to: Ti... 30 1.7 105537.m00002|conserved hypothetical protein|1113| 29 2.9 92030.m00091|conserved hypothetical protein|1971|Identical to: T... 28 5.0 >81528.m00049|Leucine Rich Repeat family protein|1890|Identical to: TigrScan, GlimmerHMM gene predictions Length = 1890 Score = 31.6 bits (70), Expect = 0.59 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +1 Query: 129 YVQAVRDTMSCGGCTCSRGSFIGACLGAQVGLEGIP 164 Y + + T+ GG T S + ACLGA G++ IP Sbjct: 1693 YKEGIEFTIRIGGDTNGNCSVVSACLGAMWGIDSIP 1800 >81529.m00498|conserved hypothetical protein|894|Identical to: TigrScan, GlimmerHMM gene predictions Length = 894 Score = 30.0 bits (66), Expect = 1.7 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = -2 Query: 137 MSCGGCTCSRG--SFIGACLGAQVGLEGIPASWSSRTQRYESVLEHAKKITSHL 188 +S G C C + SFI ACL + ++G SW +T R V SHL Sbjct: 800 VSSGFCICGQSPPSFINACLHPSIAIDGKNFSW--KTNRLSRVSIDIIAANSHL 645 >105537.m00002|conserved hypothetical protein|1113| Length = 1113 Score = 29.3 bits (64), Expect = 2.9 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -2 Query: 139 CGGCTCSRGSFIGACLGAQVG 159 C GC C G +G C+G VG Sbjct: 338 CAGCGCCAGCCVGCCVGCCVG 276 >92030.m00091|conserved hypothetical protein|1971|Identical to: TigrScan, GlimmerHMM gene predictions Length = 1971 Score = 28.5 bits (62), Expect = 5.0 Identities = 13/42 (30%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Frame = +1 Query: 65 IRQLRDPNRKQAQDLDQA--VVGHIHQVKENLSKTPQELIPA 104 ++ L+D N+K ++ + +VG+ +QVK NL+ ++L A Sbjct: 1687 LKMLQDENKKLMNEISELTEIVGNYNQVKANLATAQEDLTKA 1812 Database: genome.fa Posted date: Feb 10, 2010 10:02 AM Number of letters in database: 85,114,155 Number of sequences in database: 99,319 Lambda K H 0.319 0.132 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,054,861 Number of Sequences: 99319 Number of extensions: 148512 Number of successful extensions: 1248 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1208 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1248 length of query: 189 length of database: 28,371,385 effective HSP length: 98 effective length of query: 91 effective length of database: 18,638,123 effective search space: 1696069193 effective search space used: 1696069193 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 60 (27.7 bits)