TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SelTryp; hypothetical protein [Trypanosoma brucei TREU927] PARTIALLY FROM XP_844760.1 (259 letters) Database: genome.fa 99,319 sequences; 85,114,155 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 89416.m00091|hypothetical protein|1176| 33 0.26 93904.m00224|NAC domain containing protein|1485|Identical to: Ti... 30 2.2 87844.m00050|Endonuclease/Exonuclease/phosphatase family protein... 30 2.2 83992.m00254|hypothetical protein|558|Identical to: TigrScan, Gl... 30 2.2 85473.m00028|conserved hypothetical protein|2130| 30 3.8 >89416.m00091|hypothetical protein|1176| Length = 1176 Score = 33.5 bits (75), Expect = 0.26 Identities = 19/94 (20%), Positives = 37/94 (39%) Frame = +1 Query: 159 ILSTGFLASIAISFFAPFLRGALPPHIAEWIEQHRGMVVGAGFMMNMVASSLLQSGAFEV 218 I++ F++S A SFF + H +W+ M V M S+++ A+ Sbjct: 199 IITIFFISSFAFSFFITPSENIIKSHAIDWVNDFIQMTVQNDIMYKAFNSTIISLFAYGF 378 Query: 219 YLNGSLIYSKLETGAVPTAETLADHILRQIISGT 252 Y ++ + G + T D ++ G+ Sbjct: 379 YSIATIFFYTPNVGVITTLTIFLDRSFVSMLYGS 480 >93904.m00224|NAC domain containing protein|1485|Identical to: TigrScan, GlimmerHMM gene predictions Length = 1485 Score = 30.4 bits (67), Expect = 2.2 Identities = 35/126 (27%), Positives = 63/126 (50%), Gaps = 14/126 (11%) Frame = +1 Query: 43 KYLEMLKEADL-KQMLHEKGEAFHHLRSKRELILAVLK-----LEKREEALRKARVTDT- 95 KY + L++A+L K L ++ E + +++ E VLK ++KR ++ + + T+ Sbjct: 865 KYKQKLEDAELEKTELLKQIEIYKDIQTDHEKQEKVLKDQISEIQKRIDSGKASEETENK 1044 Query: 96 VQHEVRVEYCSGXGYRRHYEEVA--ESLLRSLPPELREQQKGKKPFIKFVG-----VVYS 148 V+ R+ S Y E+ E+ +R L +L + + PF+KFVG V+Y Sbjct: 1045VKKMNRMLEKSNMLYAELQEKYDKNETRVRELEKQLHKARIPGIPFVKFVGPKATFVLYD 1224 Query: 149 VGAFRE 154 G F+E Sbjct: 1225NGIFQE 1242 >87844.m00050|Endonuclease/Exonuclease/phosphatase family protein|1644|Identical to: GlimmerHMM gene prediction; Covered by: TigrScan gene prediction Length = 1644 Score = 30.4 bits (67), Expect = 2.2 Identities = 14/39 (35%), Positives = 25/39 (64%) Frame = +2 Query: 56 MLHEKGEAFHHLRSKRELILAVLKLEKREEALRKARVTD 94 ++H + A HL+S+ IL++L+ + AL+K R+TD Sbjct: 1139 VIHSQTRAISHLQSQITTILSILRTFFTQMALQKFRITD 1255 >83992.m00254|hypothetical protein|558|Identical to: TigrScan, GlimmerHMM gene predictions Length = 558 Score = 30.4 bits (67), Expect = 2.2 Identities = 32/143 (22%), Positives = 58/143 (40%), Gaps = 11/143 (7%) Frame = +1 Query: 46 EMLKEADLKQMLHEKGEAFHHLRSKRELILAVLKLEKREEALRKARVTDTVQHEVRVEYC 105 E+LKE KQ K A R ++E + E+ EE ++A + ++ + VE Sbjct: 142 EILKEKREKQKEISKDRA----REEKEKEKERKRQEREEEQKKRAEELEKIKATIPVEEL 309 Query: 106 SGXGYRRHYEEVAESLLRSLPPE-----------LREQQKGKKPFIKFVGVVYSVGAFRE 154 ++ + +R PPE + ++ + KF V V R Sbjct: 310 ELLYPQK------QPKIREAPPERFLCPNPGVQLVPKKARRTDASFKFEDFVEFVKPLRT 471 Query: 155 FIGNILSTGFLASIAISFFAPFL 177 ++GN + GFL ++ + F F+ Sbjct: 472 YVGNTVFNGFLTAVGVCVFIFFV 540 >85473.m00028|conserved hypothetical protein|2130| Length = 2130 Score = 29.6 bits (65), Expect = 3.8 Identities = 22/107 (20%), Positives = 47/107 (43%), Gaps = 2/107 (1%) Frame = +1 Query: 31 DNEATDYSSHRYKYLEMLKEADLKQMLHEKGEAFHHLRSKRELILAVLKLEKREEALRKA 90 D +TDYS HR K ++ K++D E + H R K ++ + K+ + + Sbjct: 1168 DEYSTDYSKHRTKTVK--KDSDSSNKYSEYSDISHASRRKADVSENSERKSKKSKTKSQT 1341 Query: 91 RVTDTVQ--HEVRVEYCSGXGYRRHYEEVAESLLRSLPPELREQQKG 135 V+ E+ ++ + Y E+ ++ +L + +++KG Sbjct: 1342 DKDQKVKSNDELSDKHSEDFQEKSRYVEIKPNISENLTQKTEKEEKG 1482 Database: genome.fa Posted date: Feb 10, 2010 10:02 AM Number of letters in database: 85,114,155 Number of sequences in database: 99,319 Lambda K H 0.321 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,237,337 Number of Sequences: 99319 Number of extensions: 207199 Number of successful extensions: 1548 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1541 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1548 length of query: 259 length of database: 28,371,385 effective HSP length: 102 effective length of query: 157 effective length of database: 18,240,847 effective search space: 2863812979 effective search space used: 2863812979 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 61 (28.1 bits)