TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SelTryp; hypothetical protein [Trypanosoma brucei TREU927] PARTIALLY FROM XP_844760.1 (259 letters) Database: genome.fa 2960 sequences; 20,171,213 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Plasmodium_yoelii_yoelii_str._17XNL|MALPY00235|2002-09-10|ds-DNA... 29 2.4 Plasmodium_yoelii_yoelii_str._17XNL|MALPY01375|2002-09-10|ds-DNA... 28 4.1 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY00235|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 3944 Score = 28.9 bits (63), Expect = 2.4 Identities = 18/40 (45%), Positives = 23/40 (57%) Frame = -3 Query: 43 KYLEMLKEADLKQMLHEKGEAFHHLRSKRELILAVLKLEK 82 KY M K +LK +LH KGEA++HL L L + K K Sbjct: 1062 KY*IMAK--NLKNILHGKGEAYYHLLKISTLFLLLEKSMK 949 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY01375|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 3707 Score = 28.1 bits (61), Expect = 4.1 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = -1 Query: 31 DNEA--TDYSSHRYKYLEMLKEADLKQMLHEKGEAF 64 DNE +DY RYK +LK + QM+ E G+ + Sbjct: 3011 DNEIGNSDYKCERYKMRNILKRSFTAQMIEEMGKIY 2904 Database: genome.fa Posted date: Feb 10, 2010 10:02 AM Number of letters in database: 20,171,213 Number of sequences in database: 2960 Lambda K H 0.321 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,181,201 Number of Sequences: 2960 Number of extensions: 48628 Number of successful extensions: 180 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 96 Number of HSP's successfully gapped in prelim test: 15 Number of HSP's that attempted gapping in prelim test: 80 Number of HSP's gapped (non-prelim): 116 length of query: 259 length of database: 6,723,737 effective HSP length: 95 effective length of query: 164 effective length of database: 6,442,537 effective search space: 1056576068 effective search space used: 1056576068 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 58 (26.9 bits)