TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SelTryp; hypothetical protein [Trypanosoma brucei TREU927] PARTIALLY FROM XP_844760.1 (259 letters) Database: genome.fa 14 sequences; 23,462,190 total letters Searching..............done Score E Sequences producing significant alignments: (bits) Value Plasmodium_knowlesi_strain_H|PK4.chr12.pseudo|2007-02-22|ds-DNA|... 30 0.99 Plasmodium_knowlesi_strain_H|PK4.chr07|2007-02-22|ds-DNA|Plasmod... 29 2.9 Plasmodium_knowlesi_strain_H|chr04|2007-02-22|ds-DNA|Plasmodium_... 28 3.8 Plasmodium_knowlesi_strain_H|PK4.chr13|2007-02-22|ds-DNA|Plasmod... 28 6.4 Plasmodium_knowlesi_strain_H|chr14|2007-02-22|ds-DNA|Plasmodium_... 28 6.4 >Plasmodium_knowlesi_strain_H|PK4.chr12.pseudo|2007-02-22|ds- DNA|Plasmodium_knowlesi_Sanger Length = 3128370 Score = 30.4 bits (67), Expect = 0.99 Identities = 27/108 (25%), Positives = 52/108 (48%), Gaps = 10/108 (9%) Frame = +3 Query: 57 LHEKGEAFHHLRSKRELILAVLKLEKREEALRKARVTDTVQHEV-RVEYCSGX--GYRRH 113 +H AF+ + K++ + + +K+EEAL K + + + + SG ++ Sbjct: 12777 VHTCMNAFNDNKKKKKGEKEIEEEKKKEEALLKEKEKSQNKLSIGNTKIYSGPLAALEKY 12956 Query: 114 YEEVAESLLRSLPPELREQQ-------KGKKPFIKFVGVVYSVGAFRE 154 +E+ E RSL + E++ KG+ K+ +VY VGA+R+ Sbjct: 12957 EDELEEERKRSLRYDKEERKRKMKGKGKGQSLLDKWQSIVYEVGAYRD 13100 Score = 27.7 bits (60), Expect = 6.4 Identities = 17/61 (27%), Positives = 28/61 (45%) Frame = +2 Query: 162 TGFLASIAISFFAPFLRGALPPHIAEWIEQHRGMVVGAGFMMNMVASSLLQSGAFEVYLN 221 TGF+ IA+ GALPPHI + H + + + + V++ + G Y+ Sbjct: 1962449 TGFIFLIALEGTC----GALPPHIQKHTRTHVRIRI*SNLSLEQVSTRAKKRGTISSYVL 1962616 Query: 222 G 222 G Sbjct: 1962617 G 1962619 >Plasmodium_knowlesi_strain_H|PK4.chr07|2007-02-22|ds- DNA|Plasmodium_knowlesi_Sanger Length = 1496036 Score = 28.9 bits (63), Expect = 2.9 Identities = 25/94 (26%), Positives = 44/94 (46%), Gaps = 7/94 (7%) Frame = -3 Query: 56 MLHEKGEAFHHLRSKRELILAVLKLEKREEALRKARVT-------DTVQHEVRVEYCSGX 108 +LH+ G F H+R V +E+R++ +K T + +H +R SG Sbjct: 599700 LLHQTGAPFTHIRR------GVKSVERRKK--KKGGNTSILSIYKEEAKHNLRG*NNSGA 599545 Query: 109 GYRRHYEEVAESLLRSLPPELREQQKGKKPFIKF 142 G +R + L + P+ Q+GK+P++KF Sbjct: 599544 GGQRR-----KIFLP*ISPQKNPTQQGKEPYLKF 599458 Score = 28.1 bits (61), Expect = 4.9 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +1 Query: 100 VRVEYCSGXGYRRHYEEVAESLLRSLPPELR 130 +R + C+G GYR+H + + +LR+ P + R Sbjct: 1231864 LRRQDCAGEGYRKHQQVL*REVLRTEPEQTR 1231956 Score = 27.7 bits (60), Expect = 6.4 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Frame = +3 Query: 31 DNEATDYSSHRYKYLEMLKE----ADLKQMLHEKGEAFHHLRSKRE 72 DN + +HR YL+ L E + +++ ++ E +LR KRE Sbjct: 1325337 DNSSVSQQTHRIPYLQRLSELIALSSYRELSDKRAEEKKNLRRKRE 1325474 >Plasmodium_knowlesi_strain_H|chr04|2007-02-22|ds- DNA|Plasmodium_knowlesi_Sanger Length = 785142 Score = 28.5 bits (62), Expect = 3.8 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 7/62 (11%) Frame = +1 Query: 139 FIKFVGVVYSVGAFREFIGNILSTGFLASIAISFFAPFL--RGALPP-----HIAEWIEQ 191 ++ VG+V G R I + LAS+ +FFAP + RG L P + EW+ + Sbjct: 433249 YVCCVGIVPPDGCVRRLIFFHFPSSHLASLCTTFFAPSVVKRGMLIPERLIERLIEWLSR 433428 Query: 192 HR 193 + Sbjct: 433429 RK 433434 Score = 27.7 bits (60), Expect = 6.4 Identities = 17/61 (27%), Positives = 28/61 (45%) Frame = -1 Query: 162 TGFLASIAISFFAPFLRGALPPHIAEWIEQHRGMVVGAGFMMNMVASSLLQSGAFEVYLN 221 TGF+ IA+ GALPPHI + H + + + + V++ + G Y+ Sbjct: 247086 TGFIFLIALEGTC----GALPPHIQKHTRTHVRIRI*SNLSLEQVSTRAKKRGTISSYVL 246919 Query: 222 G 222 G Sbjct: 246918 G 246916 >Plasmodium_knowlesi_strain_H|PK4.chr13|2007-02-22|ds- DNA|Plasmodium_knowlesi_Sanger Length = 2200295 Score = 27.7 bits (60), Expect = 6.4 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 4/74 (5%) Frame = -1 Query: 158 NILSTGFLASIAISFFAPFLRGALPPHIAEW---IEQHRGMVVGAGFMMNMVAS-SLLQS 213 N+++ FL +SFF+PF +P H+ +W I+ V F +++ S SL S Sbjct: 1314578 NVINRFFL----LSFFSPFSLSVMP*HMRKWSRRIDSSLKGFVALTFAVSISLSISLFSS 1314411 Query: 214 GAFEVYLNGSLIYS 227 F ++ S IY+ Sbjct: 1314410 IPFPLFSFKSSIYN 1314369 >Plasmodium_knowlesi_strain_H|chr14|2007-02-22|ds- DNA|Plasmodium_knowlesi_Sanger Length = 3159096 Score = 27.7 bits (60), Expect = 6.4 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 4/72 (5%) Frame = -1 Query: 31 DNEATDYSSHRYKYLEMLKEADLKQMLHEKGEAFHHL----RSKRELILAVLKLEKREEA 86 D+ +DYSSH+ K ++ K+ ++ LH K H +R + + K EKRE+ Sbjct: 1910757 DSSVSDYSSHKKKSVKKGKKKK-ERDLHTKEGVIKHFDVTTSEERNDLYSNEKGEKREDW 1910581 Query: 87 LRKARVTDTVQH 98 R+ +V H Sbjct: 1910580 NRRKKVLKKGSH 1910545 Database: genome.fa Posted date: Feb 10, 2010 10:01 AM Number of letters in database: 23,462,190 Number of sequences in database: 14 Lambda K H 0.321 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,631,871 Number of Sequences: 14 Number of extensions: 77297 Number of successful extensions: 385 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 8 Number of HSP's that attempted gapping in prelim test: 331 Number of HSP's gapped (non-prelim): 138 length of query: 259 length of database: 7,820,730 effective HSP length: 96 effective length of query: 163 effective length of database: 7,819,386 effective search space: 1274559918 effective search space used: 1274559918 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 58 (26.9 bits)