TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SelTryp; hypothetical protein [Trypanosoma brucei TREU927] PARTIALLY FROM XP_844760.1 (259 letters) Database: genome.fa 4347 sequences; 16,926,281 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Plasmodium_gallinaceum|Pg_2265551.c000241699.Contig1|2007-01-03|... 30 0.88 Plasmodium_gallinaceum|Pg_2265551.c000127926.Contig1|2007-01-03|... 27 9.7 >Plasmodium_gallinaceum|Pg_2265551.c000241699.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 1818 Score = 30.0 bits (66), Expect = 0.88 Identities = 14/55 (25%), Positives = 28/55 (50%) Frame = -1 Query: 32 NEATDYSSHRYKYLEMLKEADLKQMLHEKGEAFHHLRSKRELILAVLKLEKREEA 86 NE ++ + +KY + +KEA L + + F++ + +I L +REE+ Sbjct: 1050 NEVSNLHYNSFKYEDYIKEAQLNNCVSDGNNIFNNSNRNKNIIQDPLIFNRREES 886 >Plasmodium_gallinaceum|Pg_2265551.c000127926.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4056 Score = 26.6 bits (57), Expect = 9.7 Identities = 10/26 (38%), Positives = 21/26 (80%) Frame = +1 Query: 202 MMNMVASSLLQSGAFEVYLNGSLIYS 227 ++++V ++LL+ +F ++LN SLI+S Sbjct: 3391 LLSLVFTTLLKFSSFLIFLNSSLIFS 3468 Database: genome.fa Posted date: Feb 10, 2010 10:01 AM Number of letters in database: 16,926,281 Number of sequences in database: 4347 Lambda K H 0.321 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,325,730 Number of Sequences: 4347 Number of extensions: 37806 Number of successful extensions: 131 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 129 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 131 length of query: 259 length of database: 5,642,093 effective HSP length: 93 effective length of query: 166 effective length of database: 5,237,822 effective search space: 869478452 effective search space used: 869478452 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 57 (26.6 bits)