TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SelTryp; hypothetical protein [Trypanosoma brucei TREU927] PARTIALLY FROM XP_844760.1 (259 letters) Database: genome.fa 697 sequences; 71,881,135 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value scaffold_91 52 1e-06 scaffold_102 44 3e-04 >scaffold_91 Length = 338364 Score = 51.6 bits (122), Expect = 1e-06 Identities = 41/142 (28%), Positives = 73/142 (51%), Gaps = 4/142 (2%) Frame = -2 Query: 99 EVRVEYCSGXGYRRHYEEVAESLLRSLPPELREQQKGKKPFIKFVGVVYSVGAFREFIGN 158 E+ +EYC+ Y+ Y+++ +LL P + I +G Y +GA ++ + Sbjct: 200972 EILIEYCTS*SYKESYQKLENALLN*YPNK-----------INVIG*PYPIGA*KQLLV* 200826 Query: 159 ILS-TGFLASIAISFFAPFLRGALPPHIAEWIEQHR---GMVVGAGFMMNMVASSLLQSG 214 L+ + + I + F L+ L ++I ++ G+++ GF N + +L +G Sbjct: 200825 CLTYIQYGSLIVLVLFDSILKSKLSLW-EQYISPNKMRVGILIYIGF--NFII*NLQSTG 200655 Query: 215 AFEVYLNGSLIYSKLETGAVPT 236 AFEV +NG LI+SKL TG +PT Sbjct: 200654 AFEVTING*LIHSKLATG*MPT 200589 >scaffold_102 Length = 310338 Score = 43.5 bits (101), Expect = 3e-04 Identities = 32/113 (28%), Positives = 59/113 (52%), Gaps = 12/113 (10%) Frame = +2 Query: 140 IKFVGVVYSVGAFREFIGNILST---GFLASIA-----ISFFAPFLRGALPPHIAEWIEQ 191 ++ +G+ Y +G +E + +L+ GF+A + IS + F R + P ++ Sbjct: 105239 VEVMGMPYPLG*GKEILVQLLTIIQYGFIAGLIFFDK*ISEMSNFWRTNISPSRLKY--- 105409 Query: 192 HRGMVVGAGFM----MNMVASSLLQSGAFEVYLNGSLIYSKLETGAVPTAETL 240 GF+ +N V + L SGAFE+++N L++SK+ +G +PT +TL Sbjct: 105410 --------GFLGYIALNFVITQLSSSGAFEIFVND*LVHSKISSG*MPTMDTL 105544 Database: genome.fa Posted date: Feb 10, 2010 10:01 AM Number of letters in database: 71,881,135 Number of sequences in database: 697 Lambda K H 0.321 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,403,676 Number of Sequences: 697 Number of extensions: 162343 Number of successful extensions: 421 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 410 Number of HSP's gapped (non-prelim): 25 length of query: 259 length of database: 23,960,378 effective HSP length: 104 effective length of query: 155 effective length of database: 23,887,890 effective search space: 3702622950 effective search space used: 3702622950 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 62 (28.5 bits)