TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SelTryp; hypothetical protein [Trypanosoma brucei TREU927] PARTIALLY FROM XP_844760.1 (259 letters) Database: genome.fa 36 sequences; 32,855,403 total letters Searching....................................done Score E Sequences producing significant alignments: (bits) Value LmjF35_01_20050601_V5.2 [~/leish/curated/chr35/LmjF35_01_2005060... 103 2e-22 LmjF32_01_20050601_V5.3 [~/leish/curated/chr32/LmjF32_01_2005060... 30 2.3 LmjF15_01_20050601_V5.2 [~/leish/curated/chr15/LmjF15_01_2005060... 30 2.3 LmjF14_01_20050601_V5.2 [~/leish/curated/chr14/LmjF14_01_2005060... 29 3.0 >LmjF35_01_20050601_V5.2 [~/leish/curated/chr35/LmjF35_01_20050601_V5.2.artemis] This data was sequenced at the Sanger Institute or SBRI Length = 2090491 Score = 103 bits (256), Expect = 2e-22 Identities = 55/152 (36%), Positives = 87/152 (57%) Frame = +3 Query: 98 HEVRVEYCSGXGYRRHYEEVAESLLRSLPPELREQQKGKKPFIKFVGVVYSVGAFREFIG 157 H + V YC+G GY +++E++ + L +LP ++ VG Y R Sbjct: 510327 HALEVLYCTG*GYAKYFEDMKQQLQHTLPNAQE---------VRIVGGTYPTPPARALAA 510479 Query: 158 NILSTGFLASIAISFFAPFLRGALPPHIAEWIEQHRGMVVGAGFMMNMVASSLLQSGAFE 217 + ST FLAS+ ++ L LPP + +I Q RGM++GAGF++NM+ +L Q+GAFE Sbjct: 510480 KVCSTAFLASLGVALAGQQLV-FLPPTVLNFIAQQRGMLIGAGFLLNMIGGALGQTGAFE 510656 Query: 218 VYLNGSLIYSKLETGAVPTAETLADHILRQII 249 V L+G LI+SKL+ GAVP + +L++ + Sbjct: 510657 VSLDGELIFSKLQAGAVPAVAEIRRIVLQKTL 510752 Score = 79.7 bits (195), Expect = 2e-15 Identities = 55/172 (31%), Positives = 87/172 (50%), Gaps = 6/172 (3%) Frame = +1 Query: 94 DTVQHEVRVEYCSGXGYRRHYE----EVAESLLRSLPPELREQQKGKKPFIKFVGVVYSV 149 D QHEV V Y GY +E E+ ES + SLP ++ VG Y + Sbjct: 508084 DEAQHEVLVLYNEANGYGSKFEVLRKELQESEVVSLP---------NLADLQIVGQAYPM 508236 Query: 150 GAFREFIGNILSTGFLASIAISFFAPFLRGALPPHIAEWIEQHRGMVVGAGFMMNMVASS 209 R I L F ++ ++ L+ +P + + RG++ GF++N+++ + Sbjct: 508237 SPRRVLISKALQGAFFGTLGLALMGDQLK-FIPESVLAVLRARRGLITSTGFLLNVLSRA 508413 Query: 210 LLQSGAFEVYLNGSLIYSKLE-TGAVPTAETLADHIL-RQIISGTAAGTRTA 259 LQ+ AFEV+L+G LIYS L +G VPTAE L++ +L R ++ A +TA Sbjct: 508414 ALQNNAFEVFLDGELIYSALNASGRVPTAELLSNLLLERTLLKDYYAAAKTA 508569 Score = 47.8 bits (112), Expect = 8e-06 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 5/69 (7%) Frame = +3 Query: 36 DYSSHRYKYLEMLKEADLKQMLHEKGEA---FHHLRSKRELILAVLKLEKREEALR--KA 90 +++ Y YL+ML E DL+QML+EK R K+EL+ AV KLE+RE+A Sbjct: 509814 EHNKDPYAYLDMLDEVDLQQMLYEKTHGRVQVSAFRDKKELVAAVRKLEEREDAESSFNE 509993 Query: 91 RVTDTVQHE 99 RVT +Q + Sbjct: 509994 RVTAAMQRK 510020 Score = 29.3 bits (64), Expect = 3.0 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = +3 Query: 155 FIGNILSTGFLASIAISFFAPFLRGALPP 183 F+ LS FLAS+A+S FL ALPP Sbjct: 482628 FLSRSLSIFFLASLALSLDTRFLSPALPP 482714 >LmjF32_01_20050601_V5.3 [~/leish/curated/chr32/LmjF32_01_20050601_V5.3.artemis] This data was sequenced at the Sanger Institute or SBRI Length = 1604650 Score = 29.6 bits (65), Expect = 2.3 Identities = 24/83 (28%), Positives = 36/83 (43%), Gaps = 5/83 (6%) Frame = -3 Query: 56 MLHEKGEAFHHLRSKRELILAVLKLEKREEALRKARVTDTVQHEVRVEYC--SGXGYRRH 113 +LH HHL +R+ +L VL+ + +L T +VRV+ C R H Sbjct: 202772 ILHGVPRVLHHLCDRRKSLLVVLRKKSDRRSLLPGAARATHAVDVRVDSCWKIEVDDRAH 202593 Query: 114 YEEV---AESLLRSLPPELREQQ 133 EV + L R P+L E + Sbjct: 202592 VLEVDTARKQLRRHKDPDLAETE 202524 >LmjF15_01_20050601_V5.2 [~/leish/curated/chr15/LmjF15_01_20050601_V5.2.artemis] This data was sequenced at the Sanger Institute or SBRI Length = 629514 Score = 29.6 bits (65), Expect = 2.3 Identities = 20/78 (25%), Positives = 35/78 (44%) Frame = -3 Query: 36 DYSSHRYKYLEMLKEADLKQMLHEKGEAFHHLRSKRELILAVLKLEKREEALRKARVTDT 95 ++ HRYK + +L + LH+ G+ HHLR + + ++RE R + Sbjct: 148600 EHVHHRYKEPDK-DSRNLARHLHDGGKVLHHLRH-----VQAIGTQRRERHPRHSTGHRL 148439 Query: 96 VQHEVRVEYCSGXGYRRH 113 ++ R C+ G R H Sbjct: 148438 LRRRWRRPSCTSGGQRPH 148385 Score = 27.7 bits (60), Expect = 8.9 Identities = 14/54 (25%), Positives = 27/54 (50%) Frame = -2 Query: 81 EKREEALRKARVTDTVQHEVRVEYCSGXGYRRHYEEVAESLLRSLPPELREQQK 134 E ++A+ A TDT E + H+++ E LLR++ + ++QQ+ Sbjct: 492305 EALQDAVASASNTDTANAEALASATRPRQHHHHHKQCRERLLRNVVGQQQQQQQ 492144 >LmjF14_01_20050601_V5.2 [~/leish/curated/chr14/LmjF14_01_20050601_V5.2.artemis] This data was sequenced at the Sanger Institute or SBRI Length = 622648 Score = 29.3 bits (64), Expect = 3.0 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = -2 Query: 166 ASIAISFFAPFLRGALPP--HIAEWIEQHRGMVVG 198 A+++ S +A F R A P H+ WI++HRG V G Sbjct: 38835 AALSWSAYATFARLAHSPFPHLDYWIKKHRGRVAG 38731 Database: genome.fa Posted date: Feb 10, 2010 10:01 AM Number of letters in database: 32,855,403 Number of sequences in database: 36 Lambda K H 0.321 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,623,622 Number of Sequences: 36 Number of extensions: 121907 Number of successful extensions: 740 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 701 Number of HSP's gapped (non-prelim): 91 length of query: 259 length of database: 10,951,801 effective HSP length: 98 effective length of query: 161 effective length of database: 10,948,273 effective search space: 1762671953 effective search space used: 1762671953 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 60 (27.7 bits)