TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000003_1.0 # Protein # Iodothyronine deiodinase 3 (DI3) # Homo sapiens # Complete (278 letters) Database: genome.fa 130 sequences; 29,361,466 total letters Searching................................................................done Score E Sequences producing significant alignments: (bits) Value Tb927_11_01_v4 [~/tryp/curated/chr11/Tb927_11_01_v4.embl] This d... 30 1.4 Tb927_07_v4 [~/tryp/curated/chr7/Tb927_07_v4.embl] This data was... 30 2.3 Tb927_08_v4 [~/tryp/curated/chr8/Tb927_08_v4.embl] This data was... 28 5.2 tryp_X-48f04.q1c [~/tryp/curated/chr10/tryp_X-48f04.q1c.embl] Th... 28 8.8 >Tb927_11_01_v4 [~/tryp/curated/chr11/Tb927_11_01_v4.embl] This data was sequenced at the Sanger Institute or TIGR Length = 4977082 Score = 30.4 bits (67), Expect = 1.4 Identities = 25/88 (28%), Positives = 39/88 (44%), Gaps = 5/88 (5%) Frame = +3 Query: 72 PPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVVLPDGFQSQHILDYAQG 131 P IC+SD ++ + S + V + K F + GP +E + P S+ + D G Sbjct: 4031427 PSICMSDMFQIISPRSFERVQNKAKKLFLPS--QTGPVLPAEQLRPIQTVSKDVTDAPAG 4031600 Query: 132 NRP-----LVLNFGSCTXPPFMARMSAF 154 NRP + F S PP + M+ F Sbjct: 4031601 NRPPG**TMAGAFPSPVTPPLRSTMTKF 4031684 >Tb927_07_v4 [~/tryp/curated/chr7/Tb927_07_v4.embl] This data was sequenced at the Sanger Institute or TIGR Length = 2205233 Score = 29.6 bits (65), Expect = 2.3 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +1 Query: 53 QPEPEVELNSEGEEVPPDDPPI 74 +P+P ++S GEEVPP DP I Sbjct: 1485103 RPKPPASISSTGEEVPPLDPII 1485168 >Tb927_08_v4 [~/tryp/curated/chr8/Tb927_08_v4.embl] This data was sequenced at the Sanger Institute or TIGR Length = 2481190 Score = 28.5 bits (62), Expect = 5.2 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = +3 Query: 108 PAPNSEVVLPDGFQSQHILDYAQGNRPLVLNFGSCTXPPFMARMSA 153 P P +VLP+G +S LD PL + + P R+SA Sbjct: 1781184 PPPYVTIVLPEGVRSAAELDLTHTQSPLAVYAAATASNPIEVRVSA 1781321 >tryp_X-48f04.q1c [~/tryp/curated/chr10/tryp_X-48f04.q1c.embl] This data was sequenced at the Sanger Institute or TIGR Length = 12252 Score = 27.7 bits (60), Expect = 8.8 Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 4/33 (12%) Frame = +2 Query: 19 CLVLFPR----FLGTAFMLWLLDFLCIRKHFLG 47 CL LF FLG+ F+L+L FL R FLG Sbjct: 7691 CLCLFCHLSLLFLGSLFLLFLFGFLTQRAPFLG 7789 Database: genome.fa Posted date: Feb 10, 2010 10:02 AM Number of letters in database: 29,361,466 Number of sequences in database: 130 Lambda K H 0.322 0.139 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,554,359 Number of Sequences: 130 Number of extensions: 208684 Number of successful extensions: 777 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 619 Number of HSP's gapped (non-prelim): 324 length of query: 278 length of database: 9,787,155 effective HSP length: 98 effective length of query: 180 effective length of database: 9,774,415 effective search space: 1759394700 effective search space used: 1759394700 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 60 (27.7 bits)