TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000003_1.0 # Protein # Iodothyronine deiodinase 3 (DI3) # Homo sapiens # Complete (278 letters) Database: genome.fa 14 sequences; 23,462,190 total letters Searching..............done Score E Sequences producing significant alignments: (bits) Value Plasmodium_knowlesi_strain_H|PK4.chr03|2007-02-22|ds-DNA|Plasmod... 28 5.4 Plasmodium_knowlesi_strain_H|PK4.chr12.pseudo|2007-02-22|ds-DNA|... 27 9.3 Plasmodium_knowlesi_strain_H|PK4.chr05|2007-02-22|ds-DNA|Plasmod... 27 9.3 >Plasmodium_knowlesi_strain_H|PK4.chr03|2007-02-22|ds- DNA|Plasmodium_knowlesi_Sanger Length = 973297 Score = 28.1 bits (61), Expect = 5.4 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +3 Query: 45 FLGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNR 81 F G E + E + EGEE P DD +DDNR Sbjct: 872142 FSGISNDDDGEEDDEADDEGEEYPEDDGECNGNDDNR 872252 >Plasmodium_knowlesi_strain_H|PK4.chr12.pseudo|2007-02-22|ds- DNA|Plasmodium_knowlesi_Sanger Length = 3128370 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +1 Query: 42 RKHFLGRRRRGQPEPEVELNSEGEE-VPPDDPPI 74 R+H RRR + + +++ E EE VP +DPP+ Sbjct: 861289 REHCSKRRRTHKTDTKLKTEGEEEEEVPSEDPPV 861390 >Plasmodium_knowlesi_strain_H|PK4.chr05|2007-02-22|ds- DNA|Plasmodium_knowlesi_Sanger Length = 1324984 Score = 27.3 bits (59), Expect = 9.3 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = -3 Query: 50 RRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASLK 89 R+GQP P+V + GE DDP + + NR+ L + K Sbjct: 921395 RKGQPSPQVGQTAYGELFWEDDPFVRLRRANRVNHLDNRK 921276 Database: genome.fa Posted date: Feb 10, 2010 10:01 AM Number of letters in database: 23,462,190 Number of sequences in database: 14 Lambda K H 0.322 0.139 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,805,205 Number of Sequences: 14 Number of extensions: 155956 Number of successful extensions: 611 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 585 Number of HSP's gapped (non-prelim): 83 length of query: 278 length of database: 7,820,730 effective HSP length: 97 effective length of query: 181 effective length of database: 7,819,372 effective search space: 1415306332 effective search space used: 1415306332 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 59 (27.3 bits)