TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000003_1.0 # Protein # Iodothyronine deiodinase 3 (DI3) # Homo sapiens # Complete (278 letters) Database: genome.fa 4921 sequences; 228,543,505 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value supercont1.40 of Phytophthora infestans 36 0.23 supercont1.8 of Phytophthora infestans 30 9.7 >supercont1.40 of Phytophthora infestans Length = 1445775 Score = 35.8 bits (81), Expect = 0.23 Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 1/83 (1%) Frame = -3 Query: 181 WVTTDSPYIIPQHRSLEDRVSAARVLQQGAPGCALVLD-TMANSSSSAYGAYFERLYVIQ 239 W T SPY+IP ++ + + G P C L+++ MA++ S A L+ Q Sbjct: 636724 WATAFSPYVIPMAGTMGRTMVIPGIRDSGFPSCLLIMNHGMASADSEARKM---ALFTNQ 636554 Query: 240 SGTIMYQGGRGPDGYQVSELRTW 262 G Y+ G + V+ RTW Sbjct: 636553 QGVWNYESGT----WDVAPGRTW 636497 >supercont1.8 of Phytophthora infestans Length = 3946259 Score = 30.4 bits (67), Expect = 9.7 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 13 CAQTASCLVLFPRFLGTAFMLWLLDFLCIR 42 CA T CL +F+GT F W CIR Sbjct: 2683095 CADTTYCLRRVCKFIGTCFFAWSESACCIR 2683184 Database: genome.fa Posted date: Feb 10, 2010 10:01 AM Number of letters in database: 228,543,505 Number of sequences in database: 4921 Lambda K H 0.322 0.139 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,666,984 Number of Sequences: 4921 Number of extensions: 1663463 Number of successful extensions: 5796 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 283 Number of HSP's successfully gapped in prelim test: 85 Number of HSP's that attempted gapping in prelim test: 3022 Number of HSP's gapped (non-prelim): 3787 length of query: 278 length of database: 76,181,168 effective HSP length: 112 effective length of query: 166 effective length of database: 75,630,016 effective search space: 12554582656 effective search space used: 12554582656 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 67 (30.4 bits)