TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000002_1.0 # Protein # Iodothyronine deiodinase 2 (DI2) # Homo sapiens # Complete (265 letters) Database: genome.fa 14 sequences; 23,462,190 total letters Searching..............done Score E Sequences producing significant alignments: (bits) Value Plasmodium_knowlesi_strain_H|chr14|2007-02-22|ds-DNA|Plasmodium_... 28 5.1 Plasmodium_knowlesi_strain_H|PK4.chr12.pseudo|2007-02-22|ds-DNA|... 28 6.6 >Plasmodium_knowlesi_strain_H|chr14|2007-02-22|ds- DNA|Plasmodium_knowlesi_Sanger Length = 3159096 Score = 28.1 bits (61), Expect = 5.1 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = +2 Query: 190 DRCAAAQQLLERFSLPPQCRVVADRMDNNANIAYGVAF 227 D CA ++ L S PP C + A+G AF Sbjct: 2388959 DSCAILRETLVAISCPPHCLISGTTFGTTFGTAFGTAF 2389072 >Plasmodium_knowlesi_strain_H|PK4.chr12.pseudo|2007-02-22|ds- DNA|Plasmodium_knowlesi_Sanger Length = 3128370 Score = 27.7 bits (60), Expect = 6.6 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +3 Query: 171 AIPGDSSLSFEVKKHQNQEDRCAAAQQLLERFSLPPQCRVVAD 213 AIP S V H + E+R A++Q L R + QC + + Sbjct: 943857 AIPFSESSLLSVPCHSSFEERYIASRQTLGRINFSGQCHAIQE 943985 Score = 27.3 bits (59), Expect = 8.7 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +3 Query: 160 YIDEAHPSDGWAIPGDSSLSFEVKKHQNQEDRCA 193 Y P DGW + SS SF K+ + RC+ Sbjct: 405423 YAQSGLPYDGWRVNFKSSFSFPCKQGNSSACRCS 405524 Database: genome.fa Posted date: Feb 10, 2010 10:01 AM Number of letters in database: 23,462,190 Number of sequences in database: 14 Lambda K H 0.321 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,084,640 Number of Sequences: 14 Number of extensions: 121728 Number of successful extensions: 630 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 598 Number of HSP's gapped (non-prelim): 47 length of query: 265 length of database: 7,820,730 effective HSP length: 96 effective length of query: 169 effective length of database: 7,819,386 effective search space: 1321476234 effective search space used: 1321476234 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 59 (27.3 bits)