TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= SPP00000001_1.0 # Protein # Iodothyronine deiodinase 1 (DI1) # Homo sapiens # Complete (249 letters) Database: genome.fa 130 sequences; 29,361,466 total letters Searching................................................................done Score E Sequences producing significant alignments: (bits) Value Tb927_04_v4 [~/tryp/curated/chr4/Tb927_04_v4.embl] This data was... 32 0.30 Tb927_10_v4 [~/tryp/curated/chr10/Tb927_10_v4.embl] This data wa... 28 7.5 Tb927_11_01_v4 [~/tryp/curated/chr11/Tb927_11_01_v4.embl] This d... 27 9.8 Tb927_09_v4 [~/tryp/curated/chr9/Tb927_09_v4.embl] This data was... 27 9.8 >Tb927_04_v4 [~/tryp/curated/chr4/Tb927_04_v4.embl] This data was sequenced at the Sanger Institute or TIGR Length = 1590432 Score = 32.3 bits (72), Expect = 0.30 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = +3 Query: 41 ILAMGEKTGMTRNPHFSHDNWIPTFFSTQYFWFVLK 76 IL E + P+ S WIP+FFS YF FVL+ Sbjct: 130425 ILLWLEDLTYSSTPYTSSSWWIPSFFSPPYFTFVLR 130532 >Tb927_10_v4 [~/tryp/curated/chr10/Tb927_10_v4.embl] This data was sequenced at the Sanger Institute or TIGR Length = 4054025 Score = 27.7 bits (60), Expect = 7.5 Identities = 13/58 (22%), Positives = 24/58 (41%) Frame = -2 Query: 36 RVKRNILAMGEKTGMTRNPHFSHDNWIPTFFSTQYFWFVLKVRWQRLEDTTELGGLAP 93 + N L K G+T + ++ + W+ S QY W + + + + GL P Sbjct: 456406 KASHNTLTAPRKCGVTDHSRYNVNRWLHVHKSAQYLWIATRPASHHMAENVQ--GLHP 456239 >Tb927_11_01_v4 [~/tryp/curated/chr11/Tb927_11_01_v4.embl] This data was sequenced at the Sanger Institute or TIGR Length = 4977082 Score = 27.3 bits (59), Expect = 9.8 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -2 Query: 60 NWIPTFFSTQYFWFVLKVRWQRLEDTTELGGLAPNCPVV-RLSGQRCNIW 108 +W+P+F STQ V + R ++L+DT + A +C + RL+ R N W Sbjct: 4059288 SWLPSFISTQ----VGRGRERKLKDT*KWWRSARDCALFNRLAMPRRNCW 4059151 >Tb927_09_v4 [~/tryp/curated/chr9/Tb927_09_v4.embl] This data was sequenced at the Sanger Institute or TIGR Length = 3057547 Score = 27.3 bits (59), Expect = 9.8 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = -2 Query: 70 YFWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQRC 105 + W +K RW + + + G + P + L+G RC Sbjct: 1143216 FAWSCMKSRWNQKKHSVSNGNRCSSLPYLCLAGSRC 1143109 Database: genome.fa Posted date: Feb 10, 2010 10:02 AM Number of letters in database: 29,361,466 Number of sequences in database: 130 Lambda K H 0.324 0.138 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,314,213 Number of Sequences: 130 Number of extensions: 141277 Number of successful extensions: 876 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 773 Number of HSP's gapped (non-prelim): 334 length of query: 249 length of database: 9,787,155 effective HSP length: 97 effective length of query: 152 effective length of database: 9,774,545 effective search space: 1485730840 effective search space used: 1485730840 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 59 (27.3 bits)