TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sel2 protein; PFI1515w Plasmodium falciparum # QUERY (229 letters) Database: genome.fa 99,319 sequences; 85,114,155 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 80892.m00265|hypothetical protein|2292|Identical to: TigrScan, G... 36 0.034 85232.m00122|hypothetical protein|759| 31 1.4 80599.m00058|hypothetical protein|1320|Identical to: GlimmerHMM ... 30 1.8 92921.m00252|hypothetical protein|1491|Identical to: TigrScan, G... 30 3.1 85889.m00384|hypothetical protein|1422|Identical to: TigrScan, G... 30 3.1 95305.m00227|hypothetical protein|783| 29 4.1 92995.m00073|hypothetical protein|1293|Identical to: TigrScan, G... 29 4.1 93878.m00249|conserved hypothetical protein|1188|Identical to: G... 29 4.1 88546.m00307|hypothetical protein|1893|Identical to: GlimmerHMM ... 29 4.1 87719.m00231|hypothetical protein|4254|Identical to: TigrScan, G... 29 5.4 86492.m00136|Dynein heavy chain family protein|12027|Identical t... 29 5.4 93210.m00007|Glutenin, high molecular weight subunit PW212 precu... 28 7.0 92498.m00042|hypothetical protein|1164|Identical to: TigrScan, G... 28 7.0 88864.m00137|hypothetical protein|2805|Identical to: TigrScan, G... 28 7.0 88830.m00010|conserved hypothetical protein|7017|Identical to: T... 28 7.0 88065.m00021|hypothetical protein|2937|Identical to: TigrScan, G... 28 7.0 86622.m00281|conserved hypothetical protein|1518|Identical to: T... 28 7.0 82032.m00103|hypothetical protein|591|Identical to: TigrScan, Gl... 28 9.2 >80892.m00265|hypothetical protein|2292|Identical to: TigrScan, GlimmerHMM gene predictions Length = 2292 Score = 36.2 bits (82), Expect = 0.034 Identities = 20/50 (40%), Positives = 31/50 (62%) Frame = +1 Query: 167 EKMRKKKIIVSSIMFLAYNIIYSILCNTNEIHVYQNKNLIYKDYFNEYFF 216 EK+ K + IVSS +N+IYS +C N I V +++++I +N YFF Sbjct: 7 EKISKAREIVSST---GHNVIYSDVCYQNSISVDKSQSIILLTDYNLYFF 147 >85232.m00122|hypothetical protein|759| Length = 759 Score = 30.8 bits (68), Expect = 1.4 Identities = 18/60 (30%), Positives = 30/60 (50%) Frame = +1 Query: 59 KKNNQISIFLCRSUQSQYIINKIKNYFDILNKGRETEIYFENNNYIVDNDQKYILFLMSI 118 KKN++ LC+ Q YI+ +I+ K ++ N Y ++N + YI L+SI Sbjct: 448 KKNDKFKTILCKLYQITYILES----SNIIVKSQKPGEVILNKEYFIENQKIYIHPLLSI 615 >80599.m00058|hypothetical protein|1320|Identical to: GlimmerHMM gene prediction; Covered by: TigrScan gene prediction Length = 1320 Score = 30.4 bits (67), Expect = 1.8 Identities = 17/51 (33%), Positives = 27/51 (52%) Frame = -1 Query: 168 KMRKKKIIVSSIMFLAYNIIYSILCNTNEIHVYQNKNLIYKDYFNEYFFIQ 218 K R+ KII+ ++ I CN+N + +Y D+FN++FFIQ Sbjct: 1131 KNRRNKIIIDRT-YIK*ITSNKICCNSNNF*LNLE*FRVYFDFFNQFFFIQ 982 >92921.m00252|hypothetical protein|1491|Identical to: TigrScan, GlimmerHMM gene predictions Length = 1491 Score = 29.6 bits (65), Expect = 3.1 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Frame = +1 Query: 37 SSFLKSSYEL--LFVQKDVLLPHIKKNNQISIFLCRSUQSQYIINKIKNY 84 SS +YE+ L ++K V + KN ++F + +SQYIIN +K+Y Sbjct: 1324 SSIFLENYEIASLLLEKGVDPNEVDKNGYSAMFYAKK-KSQYIINLLKSY 1470 >85889.m00384|hypothetical protein|1422|Identical to: TigrScan, GlimmerHMM gene predictions Length = 1422 Score = 29.6 bits (65), Expect = 3.1 Identities = 13/52 (25%), Positives = 28/52 (53%) Frame = +1 Query: 154 SFLLNNTKFIETFEKMRKKKIIVSSIMFLAYNIIYSILCNTNEIHVYQNKNL 205 +FLLN++ E ++ +I+ + + F+ +++ SIL + +N NL Sbjct: 1264 TFLLNSSHHAELIQQFENSEIVETLLDFIPNDLVVSILKRLEYFEILENLNL 1419 >95305.m00227|hypothetical protein|783| Length = 783 Score = 29.3 bits (64), Expect = 4.1 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = +1 Query: 161 KFIETFEKMRKKKIIVSSIMFLAYNIIYSILCNTNEIHVYQNKNLIYKDYFNEYF 215 KFI E RK I +I+ +++ + NT + + N + +DYF YF Sbjct: 382 KFIFNLENQRKYAIYALTIITRMLHLLTDDVVNTFPVEEFSNVSWRSQDYFLSYF 546 >92995.m00073|hypothetical protein|1293|Identical to: TigrScan, GlimmerHMM gene predictions Length = 1293 Score = 29.3 bits (64), Expect = 4.1 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 7/70 (10%) Frame = -1 Query: 53 VLLPHIKKNNQISIFLCRSUQSQYIINKIKNYFDILNKGRE---TEIYFENNNYIVDN-- 107 V L H+K + +++F+C + + K N FD L T IYF N DN Sbjct: 519 VHLQHVKSSISVAVFVCEKIFIEIVDRKAFNTFDELTIELALIFTHIYFGRTN*SKDNCI 340 Query: 108 --DQKYILFL 115 D++ + FL Sbjct: 339 TTDKRNLWFL 310 >93878.m00249|conserved hypothetical protein|1188|Identical to: GlimmerHMM gene prediction; Covered by: TigrScan gene prediction Length = 1188 Score = 29.3 bits (64), Expect = 4.1 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = -1 Query: 166 FEKMRKKKIIVSSIMFLAYNIIYSILCNTNEIHV-YQNKNLIYKDYFNEYFFIQTL 220 F+ + KI SI +++ IY+I N ++ Y+ N+I +YFN ++FI+ + Sbjct: 540 FKTIDCTKIGAISI*MISWKTIYAI*VNAIFFYI*YKCFNIIIHNYFNYWYFIEII 373 >88546.m00307|hypothetical protein|1893|Identical to: GlimmerHMM gene prediction; Covered by: TigrScan gene prediction Length = 1893 Score = 29.3 bits (64), Expect = 4.1 Identities = 16/58 (27%), Positives = 34/58 (58%), Gaps = 2/58 (3%) Frame = +2 Query: 160 TKFIETFEKMRK--KKIIVSSIMFLAYNIIYSILCNTNEIHVYQNKNLIYKDYFNEYF 215 +K++ + +KM + +I+ SI L Y+++ S + +H+ ++ L+Y YF+ YF Sbjct: 308 SKWLVSLKKMTRLLSILIILSIYRLEYSLL-SPFSHWRFLHMIISQELVYSQYFSRYF 478 >87719.m00231|hypothetical protein|4254|Identical to: TigrScan, GlimmerHMM gene predictions Length = 4254 Score = 28.9 bits (63), Expect = 5.4 Identities = 17/48 (35%), Positives = 28/48 (58%) Frame = +1 Query: 63 QISIFLCRSUQSQYIINKIKNYFDILNKGRETEIYFENNNYIVDNDQK 110 QIS+ Q++ I NK+K Y+ NK RE F++ N ++ ++QK Sbjct: 1420 QISVITLYKGQAKNIRNKLKEYWMTKNKERE----FDDYNPLLLSEQK 1551 >86492.m00136|Dynein heavy chain family protein|12027|Identical to: TigrScan, GlimmerHMM gene predictions Length = 12027 Score = 28.9 bits (63), Expect = 5.4 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = +2 Query: 167 EKMRKKKIIVSSIMFLAYNIIYSILCNTNEIHVYQ-NKNLIYKDYFNEYFFIQTLRTNL 224 EKM + + +SIM + I+ SIL N ++ H+ + N N++ + +IQ + N+ Sbjct: 461 EKMAEDIALFTSIMPMINQILTSILTNLSKFHLQKSNLNILLCQHKESRIYIQMAQQNV 637 >93210.m00007|Glutenin, high molecular weight subunit PW212 precursor.-related|1266|Identical to: TigrScan, GlimmerHMM gene predictions Length = 1266 Score = 28.5 bits (62), Expect = 7.0 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -1 Query: 187 IYSILCNTNEIHVYQNKNLIYKDYFNEYFFIQTLRTN 223 +Y C N H+Y + +L++ D+ F+I T+R N Sbjct: 510 LYISRCWWN*FHIYHSCHLLFFDFLVNSFYIITVRVN 400 >92498.m00042|hypothetical protein|1164|Identical to: TigrScan, GlimmerHMM gene predictions Length = 1164 Score = 28.5 bits (62), Expect = 7.0 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 49 VQKDVLLPHIKKNNQISIFLCRSUQSQYIINKIKNYF 85 V +D K N+I++ LCR +I++ IK YF Sbjct: 913 VIRDAFAKSKMKRNEINLVLCRGACINHILDYIKEYF 1023 >88864.m00137|hypothetical protein|2805|Identical to: TigrScan, GlimmerHMM gene predictions Length = 2805 Score = 28.5 bits (62), Expect = 7.0 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 4/70 (5%) Frame = -2 Query: 149 EFFIP--SFLLNNTKFIETFEKMRKKKIIVS--SIMFLAYNIIYSILCNTNEIHVYQNKN 204 +FF+ +FL N F+E FEK + ++I S + ++ +I SI C + ++ N Sbjct: 1190 DFFVSKSTFLFNFLSFLEDFEKSKIFELIFSFLDVNSFSFELISSISCVFSCSRLFFNSI 1011 Query: 205 LIYKDYFNEY 214 + +F E+ Sbjct: 1010 *LESKFFAEF 981 >88830.m00010|conserved hypothetical protein|7017|Identical to: TigrScan, GlimmerHMM gene predictions Length = 7017 Score = 28.5 bits (62), Expect = 7.0 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -1 Query: 187 IYSILCNTNEIHVYQNKNLIYKDYFNEYFFIQTLRTN 223 +Y C N H+Y + +L++ D+ F+I T+R N Sbjct: 4599 LYISRCWWN*FHIYHSCHLLFFDFLFNSFYIITVRVN 4489 >88065.m00021|hypothetical protein|2937|Identical to: TigrScan, GlimmerHMM gene predictions Length = 2937 Score = 28.5 bits (62), Expect = 7.0 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 2/71 (2%) Frame = -1 Query: 148 CEFFIPSFLLNNTKFIETFEKMRKKKII-VSSIMFLAYNIIYSILCNTN-EIHVYQNKNL 205 CE FI LL + + F K R + +I ++ L ++S+ ++ I ++ N Sbjct: 2583 CEDFIMFILLFSRIIVILFHKFRDRDLIRFNNFFLLVL*KLFSLF*FSHFVIKIFCNLIF 2404 Query: 206 IYKDYFNEYFF 216 + D+FN YFF Sbjct: 2403 LIIDFFNHYFF 2371 >86622.m00281|conserved hypothetical protein|1518|Identical to: TigrScan, GlimmerHMM gene predictions Length = 1518 Score = 28.5 bits (62), Expect = 7.0 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -1 Query: 187 IYSILCNTNEIHVYQNKNLIYKDYFNEYFFIQTLRTN 223 +Y C N H+Y + +L++ D+ F+I T+R N Sbjct: 1239 LYISRCWWN*FHIYHSCHLLFFDFLFNSFYIITVRVN 1129 >82032.m00103|hypothetical protein|591|Identical to: TigrScan, GlimmerHMM gene predictions Length = 591 Score = 28.1 bits (61), Expect = 9.2 Identities = 19/68 (27%), Positives = 34/68 (50%) Frame = +1 Query: 19 SYDFIFLKNEDNIIKGKGSSFLKSSYELLFVQKDVLLPHIKKNNQISIFLCRSUQSQYII 78 SYD I + E+N+ + F+ S E + + DV L I ++N+++ ++QY I Sbjct: 76 SYDDILINEEENLSNVDQNFFISESDEFV-SESDVELDIISRSNEVA--RDEEPKNQYFI 246 Query: 79 NKIKNYFD 86 + FD Sbjct: 247 ESDSSDFD 270 Database: genome.fa Posted date: Feb 10, 2010 10:02 AM Number of letters in database: 85,114,155 Number of sequences in database: 99,319 Lambda K H 0.326 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,035,190 Number of Sequences: 99319 Number of extensions: 355872 Number of successful extensions: 3763 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 3725 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3761 length of query: 229 length of database: 28,371,385 effective HSP length: 100 effective length of query: 129 effective length of database: 18,439,485 effective search space: 2378693565 effective search space used: 2378693565 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 61 (28.1 bits)