TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= SPP00000013_1.0 # Protein # Selenoprotein 15 (Sel15) # Homo sapiens # Complete (124 letters) Database: yoelii.fasta 2960 sequences; 20,171,213 total letters Searching..................................................done ***** No hits found ****** TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= SPP00000014_1.0 # Protein # Selenoprotein H (SelH) # Homo sapiens # Complete (122 letters) Database: yoelii.fasta 2960 sequences; 20,171,213 total letters Searching..................................................done ***** No hits found ****** TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= SPP00000015_1.0 # Protein # Selenoprotein I (SelI) # Homo sapiens # Complete (397 letters) Database: yoelii.fasta 2960 sequences; 20,171,213 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Plasmodium_yoelii_yoelii_str._17XNL|MALPY01779|2002-09-10|ds-DNA... 50 3e-06 Plasmodium_yoelii_yoelii_str._17XNL|MALPY01406|2002-09-10|ds-DNA... 30 1.8 Plasmodium_yoelii_yoelii_str._17XNL|MALPY02219|2002-09-10|ds-DNA... 29 4.9 Plasmodium_yoelii_yoelii_str._17XNL|MALPY00974|2002-09-10|ds-DNA... 28 6.4 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY01779|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 12024 Score = 49.7 bits (117), Expect = 3e-06, Method: Composition-based stats. Identities = 25/49 (51%), Positives = 35/49 (71%), Gaps = 2/49 (4%) Frame = +1 Query: 98 FVAYTLDGVDGKQARRTNSSTPLGELFDHGLDSWSCV--YFVVTVYSIF 144 F+ T D +DGKQARRTN+S+ LG+LFDHG D+ + V +F +Y +F Sbjct: 1402 FLL*TFDSIDGKQARRTNTSSALGQLFDHGCDAITSVRFFFKSNIYILF 1548 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY01406|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 15024 Score = 30.0 bits (66), Expect = 1.8, Method: Composition-based stats. Identities = 13/41 (31%), Positives = 26/41 (63%) Frame = -1 Query: 247 KNNTLKLNSVYEAMVPLFSPCLLFILSTAWILWSPSDILEL 287 + + +K+ + Y ++ LFSPC L + A+++ S +D LE+ Sbjct: 3531 RYHVIKIETAYPYIL-LFSPCFLLVFLLAYLVISSADCLEI 3412 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY02219|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 9244 Score = 28.9 bits (63), Expect = 4.9, Method: Composition-based stats. Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 4/49 (8%) Frame = -2 Query: 216 FLYRDLFTAMII--GCALCV--TLPMSLLNFFRSYKNNTLKLNSVYEAM 260 F+Y ++F ++ CA+C+ L +SLL FF Y NN L + + ++ Sbjct: 6471 FVYENIFKNIVDFHYCAICIHKCLYLSLLFFFSDYNNNNLSIGQILSSL 6325 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY00974|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 7156 Score = 28.5 bits (62), Expect = 6.4, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 3/63 (4%) Frame = -3 Query: 195 FVYIVTAVVGVEAWYEPFLFNFL---YRDLFTAMIIGCALCVTLPMSLLNFFRSYKNNTL 251 F+Y+ ++ + + F+FNFL Y D+F I + FFR+Y+N Sbjct: 1748 FIYMYFQIISILKKNDLFIFNFLLSIYVDIFVHKFIKWG-------DIFLFFRNYRNKNS 1590 Query: 252 KLN 254 + N Sbjct: 1589 EQN 1581 TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= SPP00000016_1.0 # Protein # Selenoprotein K (SelK) # Homo sapiens # Complete (94 letters) Database: yoelii.fasta 2960 sequences; 20,171,213 total letters Searching..................................................done ***** No hits found ****** TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= SPP00000017_1.0 # Protein # Selenoprotein M (SelM) # Homo sapiens # Complete (145 letters) Database: yoelii.fasta 2960 sequences; 20,171,213 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Plasmodium_yoelii_yoelii_str._17XNL|MALPY01158|2002-09-10|ds-DNA... 26 6.6 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY01158|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 8952 Score = 25.8 bits (55), Expect = 6.6, Method: Composition-based stats. Identities = 22/81 (27%), Positives = 41/81 (50%), Gaps = 7/81 (8%) Frame = -2 Query: 35 SGLTRARVETCGGU-QLNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELE 93 SG+ + ++ GG +RLK +++Q + V H+ GA ++L +RY + Sbjct: 1040 SGVPKNKIVGLGGVLDTSRLK---YYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVG 870 Query: 94 RIPLSE------MTREEINAL 108 IPL E +T +E++A+ Sbjct: 869 GIPLQEFINNKKITDQELDAI 807 TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= SPP00000018_1.0 # Protein # Selenoprotein N (SelN) # Homo sapiens # Complete (590 letters) Database: yoelii.fasta 2960 sequences; 20,171,213 total letters Searching..................................................done ***** No hits found ****** TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= SPP00000019_1.0 # Protein # Selenoprotein O (SelO) # Homo sapiens # Complete (669 letters) Database: yoelii.fasta 2960 sequences; 20,171,213 total letters Searching..................................................done ***** No hits found ****** TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= SPP00000020_1.0 # Protein # Selenoprotein P (SelP) # Homo sapiens # Complete (381 letters) Database: yoelii.fasta 2960 sequences; 20,171,213 total letters Searching..................................................done ***** No hits found ****** TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= SPP00000021_1.0 # Protein # Methionine-R-sufoxide reductase 1 (SelR1) # Homo sapiens # Complete (116 letters) Database: yoelii.fasta 2960 sequences; 20,171,213 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Plasmodium_yoelii_yoelii_str._17XNL|MALPY00216|2002-09-10|ds-DNA... 27 1.7 Plasmodium_yoelii_yoelii_str._17XNL|MALPY01888|2002-09-10|ds-DNA... 27 2.3 Plasmodium_yoelii_yoelii_str._17XNL|MALPY02440|2002-09-10|ds-DNA... 25 6.8 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY00216|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 38432 Score = 26.9 bits (58), Expect = 1.7, Method: Composition-based stats. Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 65 EALKVSCGKCGNGLGHEF 82 E + + CG+CGN +G EF Sbjct: 24245 EIITLQCGQCGNQIGVEF 24192 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY01888|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 3096 Score = 26.6 bits (57), Expect = 2.3, Method: Composition-based stats. Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 65 EALKVSCGKCGNGLGHEF 82 E + + G+CGN LGHEF Sbjct: 1058 EIIFLHVGQCGNQLGHEF 1111 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY02440|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 6256 Score = 25.0 bits (53), Expect = 6.8, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -2 Query: 29 ELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVS 70 ELF S SK + +P+F TIH + S++LK S Sbjct: 1461 ELFLSVSKRCCDNEYPSFANTIHINVTCSLLFSLISDSLKCS 1336 TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= SPP00000022_1.0 # Protein # Methionine-R-sufoxide reductase 2 (SelR2) # Homo sapiens # Complete (199 letters) Database: yoelii.fasta 2960 sequences; 20,171,213 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Plasmodium_yoelii_yoelii_str._17XNL|MALPY00463|2002-09-10|ds-DNA... 27 6.0 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY00463|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 21463 Score = 26.9 bits (58), Expect = 6.0, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -2 Query: 99 NKEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSE 132 N EAG+ CV C + + KKYC + F E Sbjct: 4428 NFEAGIQECVICMYNIILNNKKYCITPCYHIFHE 4327 TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= SPP00000023_1.0 # Protein # Methionine-R-sufoxide reductase 3 (SelR3) # Homo sapiens # Complete (192 letters) Database: yoelii.fasta 2960 sequences; 20,171,213 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Plasmodium_yoelii_yoelii_str._17XNL|MALPY01707|2002-09-10|ds-DNA... 27 4.7 Plasmodium_yoelii_yoelii_str._17XNL|MALPY01623|2002-09-10|ds-DNA... 27 8.1 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY01707|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 11279 Score = 27.3 bits (59), Expect = 4.7, Method: Composition-based stats. Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +1 Query: 39 KNCKVVFSQQELRKRLTPLQYHVT 62 KNC + Q ELRKR+ P +++ Sbjct: 463 KNCMCIILQPELRKRMLPGNLYIS 534 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY01623|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 3062 Score = 26.6 bits (57), Expect = 8.1, Method: Composition-based stats. Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +2 Query: 38 KKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEG-EYTHHKD 80 KKNC V S P Y T EKG++ +G E+ H +D Sbjct: 1544 KKNCSVKCSISSFPTIEKPKNYVETFEKGSDKTVKGPEHLHAQD 1675 TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= SPP00000024_1.0 # Protein # Selenoprotein S (SelS) # Homo sapiens # Complete (189 letters) Database: yoelii.fasta 2960 sequences; 20,171,213 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Plasmodium_yoelii_yoelii_str._17XNL|MALPY02933|2002-09-10|ds-DNA... 28 3.0 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY02933|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 2201 Score = 27.7 bits (60), Expect = 3.0, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 136 QEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEG 170 Q+ + PGP + + + SDR P+R P+ G G Sbjct: 2123 QQAEQPGPGCAGLRRLHSDRSPVRWA*AFPVPGPG 2019 TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= SPP00000025_1.0 # Protein # Selenoprotein T (SelT) # Homo sapiens # Complete (195 letters) Database: yoelii.fasta 2960 sequences; 20,171,213 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Plasmodium_yoelii_yoelii_str._17XNL|MALPY00402|2002-09-10|ds-DNA... 30 0.72 Plasmodium_yoelii_yoelii_str._17XNL|MALPY00255|2002-09-10|ds-DNA... 29 1.7 Plasmodium_yoelii_yoelii_str._17XNL|MALPY01668|2002-09-10|ds-DNA... 27 4.1 Plasmodium_yoelii_yoelii_str._17XNL|MALPY00812|2002-09-10|ds-DNA... 27 7.0 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY00402|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 7116 Score = 30.0 bits (66), Expect = 0.72, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = -3 Query: 36 ATGPLLKFQICVSUGYRRVFEEYMRVISQRYPDIRIEGENYLPQPIYRHIASFLSV 91 A P L Q+C++ G+ RVFE P R E N YRH+ ++S+ Sbjct: 2431 AQSPQLYKQMCINSGFDRVFE--------IAPVFRAENSN-----TYRHLCEYVSL 2303 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY00255|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 23991 Score = 28.9 bits (63), Expect = 1.7, Method: Composition-based stats. Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +2 Query: 126 VYACMMVFFLSNMIENQCM 144 VYAC+ ++FLS MI+ CM Sbjct: 6419 VYACLFLYFLSYMIDIPCM 6475 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY01668|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 11026 Score = 27.3 bits (59), Expect = 4.1, Method: Composition-based stats. Identities = 10/43 (23%), Positives = 25/43 (58%) Frame = -3 Query: 92 FKLVLIGLIIVGKDPFAFFGMQAPSIWQWGQENKVYACMMVFF 134 F +L L+ + +D + + + S+W + ++NK+ C+ ++F Sbjct: 9329 FPDILFYLLYIHQDKSSLYHIVHKSLWNF*KQNKILYCIYIYF 9201 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY00812|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 4415 Score = 26.6 bits (57), Expect = 7.0, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -2 Query: 66 YPDIRIEGENYLPQPIYRHIASFLSVFKLVLI 97 YPDI+I + +++ S LS FKL+L+ Sbjct: 616 YPDIKIASFIHFVTNVFKIFDSILSFFKLILL 521 TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= SPP00000026_1.0 # Protein # Selenoprotein U1 (SelU1) # Homo sapiens # Complete (229 letters) Database: yoelii.fasta 2960 sequences; 20,171,213 total letters Searching..................................................done ***** No hits found ****** TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= SPP00000027_1.0 # Protein # Selenoprotein U2 (SelU2) # Homo sapiens # Complete (226 letters) Database: yoelii.fasta 2960 sequences; 20,171,213 total letters Searching..................................................done ***** No hits found ****** TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= SPP00000028_1.0 # Protein # Selenoprotein U3 (SelU3) # Homo sapiens # Complete (198 letters) Database: yoelii.fasta 2960 sequences; 20,171,213 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Plasmodium_yoelii_yoelii_str._17XNL|MALPY02047|2002-09-10|ds-DNA... 28 2.8 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY02047|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 6027 Score = 28.1 bits (61), Expect = 2.8, Method: Composition-based stats. Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +1 Query: 80 EFLDGDYFAGELYLDESKQLYKELGFKRYNSLSILPAALGKPVRDV 125 EF + DY+ E+Y YKE +K NS+ + + K V++V Sbjct: 5455 EFNNIDYYFKEMYETLHNSTYKEDAYKILNSIFSVSNHMNKDVKNV 5592 TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= SPP00000029_1.0 # Protein # Selenoprotein V (SelV) # Homo sapiens # Complete (346 letters) Database: yoelii.fasta 2960 sequences; 20,171,213 total letters Searching..................................................done ***** No hits found ****** TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= SPP00000030_1.0 # Protein # Selenoprotein W1 (SelW1) # Homo sapiens # Complete (87 letters) Database: yoelii.fasta 2960 sequences; 20,171,213 total letters Searching..................................................done ***** No hits found ****** TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= SPP00000031_1.0 # Protein # Selenoprotein W2 (SelW2) # Homo sapiens # Complete (115 letters) Database: yoelii.fasta 2960 sequences; 20,171,213 total letters Searching..................................................done ***** No hits found ****** Database: yoelii.fasta Posted date: Mar 5, 2008 11:48 AM Number of letters in database: 20,171,213 Number of sequences in database: 2960 Lambda K H 0.330 0.142 0.482 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2960 Number of Hits to DB: 77,734,948 Number of extensions: 1092768 Number of successful extensions: 5085 Number of sequences better than 10.0: 59 Number of HSP's gapped: 5071 Number of HSP's successfully gapped: 59 Length of database: 6,723,737 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 43 (21.2 bits)