TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= SPP00000037_1.0 # Protein # SECIS binding protein 2 (SBP2) # Homo sapiens # Complete (854 letters) Database: yoelii.fasta 2960 sequences; 20,171,213 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Plasmodium_yoelii_yoelii_str._17XNL|MALPY00816|2002-09-10|ds-DNA... 44 4e-04 Plasmodium_yoelii_yoelii_str._17XNL|MALPY02899|2002-09-10|ds-DNA... 30 7.1 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY00816|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 8272 Score = 43.5 bits (101), Expect = 4e-04, Method: Composition-based stats. Identities = 28/110 (25%), Positives = 53/110 (48%) Frame = +3 Query: 631 DYCSQMLSKEVDACVTDLLKELVRFQDRMYQKDPVKAKTKRRLVLGLREVXXXXXXXXXX 690 DY +++E++ V D LK++ + D++ + G++E Sbjct: 1044 DYVDHKITEELNNMVKDFLKKISKSHDKLLLLKKKRRYYL-----GMKECYKHICINEPK 1208 Query: 691 CVIISPNCEKIQSKGGLDDTLHTIIDYACEQNIPFVFALNRKALGRSLNK 740 V+++PN E + DD ++ I+ E+NIP VFAL++ LG+ + K Sbjct: 1209 LVLVAPNIEPTLNNV-FDDMINKIVCKCKEKNIPLVFALSKNILGKCIGK 1355 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY02899|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 2131 Score = 29.6 bits (65), Expect = 7.1, Method: Composition-based stats. Identities = 18/51 (35%), Positives = 24/51 (47%) Frame = +3 Query: 772 AYKTMLENVQQELVGEPRPQAPPSLPTQGPSCPAEDGPPALKEKEEPHYIE 822 A+ + ++ Q L G PQ G PAED PP L+ E PH I+ Sbjct: 1356 AFGCLFPDLAQRLDG--LPQGELLTVASGDEPPAEDLPPRLQPPEHPHQIQ 1502 Database: yoelii.fasta Posted date: Mar 5, 2008 11:48 AM Number of letters in database: 20,171,213 Number of sequences in database: 2960 Lambda K H 0.311 0.128 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2960 Number of Hits to DB: 12,905,320 Number of extensions: 157086 Number of successful extensions: 488 Number of sequences better than 10.0: 4 Number of HSP's gapped: 485 Number of HSP's successfully gapped: 4 Length of query: 854 Length of database: 6,723,737 Length adjustment: 105 Effective length of query: 749 Effective length of database: 6,412,937 Effective search space: 4803289813 Effective search space used: 4803289813 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 47 (22.7 bits)