TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= SPP00000012_1.0 # Protein # Methionine sulfoxide reductase A (MsrA) # Homo sapiens # Complete (235 letters) Database: yoelii.fasta 2960 sequences; 20,171,213 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Plasmodium_yoelii_yoelii_str._17XNL|MALPY02647|2002-09-10|ds-DNA... 27 7.9 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY02647|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 5050 Score = 26.9 bits (58), Expect = 7.9, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -1 Query: 123 YQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQY 157 Y +H E ++K E HD G + G HG Q+ Sbjct: 4552 YMYKHKKMEIIMKKHDEQHDEQHGEQHGEQHGEQH 4448 TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= SPP00000078_1.0 # Protein # Methionine sulfoxide reductase A (MsrA) # Mus musculus # Complete (233 letters) Database: yoelii.fasta 2960 sequences; 20,171,213 total letters Searching..................................................done ***** No hits found ****** TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= SPP00000039_1.0 # Protein # Methionine sulfoxide reductase A (MsrA) # Drosophila melanogaster # Complete (246 letters) Database: yoelii.fasta 2960 sequences; 20,171,213 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Plasmodium_yoelii_yoelii_str._17XNL|MALPY02707|2002-09-10|ds-DNA... 27 7.7 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY02707|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 3255 Score = 26.9 bits (58), Expect = 7.7, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 25/43 (58%) Frame = +1 Query: 130 HDEEQKQVAHASKLEEQERRAPEIITTEIASKENFYPAEAYHQ 172 HD+ + K+ +Q+++ IIT +IA+K +Y + +H+ Sbjct: 727 HDQINNGSTFSPKISDQKKKTQNIITLQIATK-FYYSLKNFHK 852 TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= SPP00000049_1.0 # Protein # Methionine sulfoxide reductase A1 (MsrA1) # Anopheles gambiae # Complete (236 letters) Database: yoelii.fasta 2960 sequences; 20,171,213 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Plasmodium_yoelii_yoelii_str._17XNL|MALPY00946|2002-09-10|ds-DNA... 29 2.2 Plasmodium_yoelii_yoelii_str._17XNL|MALPY01972|2002-09-10|ds-DNA... 28 2.4 Plasmodium_yoelii_yoelii_str._17XNL|MALPY02407|2002-09-10|ds-DNA... 28 2.6 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY00946|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 10425 Score = 28.9 bits (63), Expect = 2.2, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = +2 Query: 108 RMKRQYMSLILYHNEQQRQIAEASRAEEQVK 138 R ++QYMSL L+ N+ + + ++S E ++K Sbjct: 8456 RTQKQYMSLNLFSNKNKNEEYDSSSNESEIK 8548 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY01972|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 4410 Score = 28.5 bits (62), Expect = 2.4, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 28/53 (52%) Frame = -1 Query: 95 DLFWNNHEYGLTTRMKRQYMSLILYHNEQQRQIAEASRAEEQVKRAPEQIITE 147 D+FWNN++ G +++ Y + N+ +IA+ Q + P +++++ Sbjct: 3405 DIFWNNNKVGKSSQAVYAYFVCVCLENKPSSKIAK*QNC--QAAKLPSKVLSK 3253 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY02407|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 3950 Score = 28.5 bits (62), Expect = 2.6, Method: Composition-based stats. Identities = 32/161 (19%), Positives = 70/161 (43%), Gaps = 11/161 (6%) Frame = +2 Query: 65 ESPAYKKMGDHTEVIEIDYDPQTISY--NDLLDLFWNNHEYGLTTRMKRQYMSLILYHNE 122 E+P Y+K+ ++++ D + + I+Y N + + N + ++++ + Sbjct: 2189 ENPEYEKLSSKNKIVQNDINHEMINYKNNAIFNKSLQNEKASQCLQLEKTFDDKT---KN 2359 Query: 123 QQRQIAEASRAEEQVKRAP---EQIITEIAPAGPFYPAEN---YHQKYRLQGHTDLAKGI 176 + +I EA + +Q+ AP +Q+ +G A+ Y +K +L +L I Sbjct: 2360 ESGKIGEAPKESDQLCEAPKESDQLCEAPKESGQLCEAQKGYGYIEKDKLYIINNLKNKI 2539 Query: 177 GLTPDLLHTSHVAARL---NGYLIGVSGLKQFEDEADLLGL 214 +T ++ + NG + GLK E+ + L+ L Sbjct: 2540 KVTCSKINNISFVEEMHYSNGSYKIILGLKNVENNSYLIKL 2662 TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= SPP00000050_1.0 # Protein # Methionine sulfoxide reductase A2 (MsrA2) # Anopheles gambiae # Complete (236 letters) Database: yoelii.fasta 2960 sequences; 20,171,213 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Plasmodium_yoelii_yoelii_str._17XNL|MALPY00946|2002-09-10|ds-DNA... 29 2.0 Plasmodium_yoelii_yoelii_str._17XNL|MALPY01972|2002-09-10|ds-DNA... 28 2.4 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY00946|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 10425 Score = 28.9 bits (63), Expect = 2.0, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = +2 Query: 108 RMKRQYMSLILYHNEQQRQIAEASRAEEQVK 138 R ++QYMSL L+ N+ + + ++S E ++K Sbjct: 8456 RTQKQYMSLNLFSNKNKNEEYDSSSNESEIK 8548 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY01972|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 4410 Score = 28.5 bits (62), Expect = 2.4, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 28/53 (52%) Frame = -1 Query: 95 DLFWNNHEYGLTTRMKRQYMSLILYHNEQQRQIAEASRAEEQVKRAPEQIITE 147 D+FWNN++ G +++ Y + N+ +IA+ Q + P +++++ Sbjct: 3405 DIFWNNNKVGKSSQAVYAYFVCVCLENKPSSKIAK*QNC--QAAKLPSKVLSK 3253 TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= SPP00000075_1.0 # Protein # Methionine sulfoxide reductase A (MsrA) # Saccharomyces cerevisae # Complete (184 letters) Database: yoelii.fasta 2960 sequences; 20,171,213 total letters Searching..................................................done ***** No hits found ****** Database: yoelii.fasta Posted date: Mar 5, 2008 11:48 AM Number of letters in database: 20,171,213 Number of sequences in database: 2960 Lambda K H 0.317 0.133 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2960 Number of Hits to DB: 27,775,372 Number of extensions: 373445 Number of successful extensions: 1121 Number of sequences better than 10.0: 17 Number of HSP's gapped: 1120 Number of HSP's successfully gapped: 23 Length of database: 6,723,737 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 42 (20.8 bits)