TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= PF14_0251_changed | Plasmodium falciparum 3D7 | Sel4 protein|conserved Plasmodium selenoprotein, unknown function | protein | length=135 (135 letters) Database: genome.fa 2960 sequences; 20,171,213 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Plasmodium_yoelii_yoelii_str._17XNL|MALPY02554|2002-09-10|ds-DNA... 50 3e-07 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY02554|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 5959 Score = 50.1 bits (118), Expect = 3e-07, Method: Composition-based stats. Identities = 40/96 (41%), Positives = 52/96 (54%), Gaps = 1/96 (1%) Frame = -2 Query: 36 KILKKNKKDAEVKRNNEISIKMKLSREKQLQELDXXXX-XXXXXXXXXXXXXXXXXXXXX 94 K +K K +E KRNNEI KMK+SREKQLQ+L+ Sbjct: 1740 KYVKYKSKISEAKRNNEIYEKMKISREKQLQKLEEEMIINKKKMNENLKNTDKENNNKTL 1561 Query: 95 XXXXPKLGSKDNSSFNHLNDYSNYYRPSLKNRFYNN 130 PK SKD S+F+H DYSNYY+PS+++R YN+ Sbjct: 1560 DSSTPKSNSKDKSTFSHFKDYSNYYKPSIRDRLYNH 1453 Database: genome.fa Posted date: Feb 25, 2008 2:31 PM Number of letters in database: 20,171,213 Number of sequences in database: 2960 Lambda K H 0.315 0.129 0.353 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2960 Number of Hits to DB: 2,621,861 Number of extensions: 29794 Number of successful extensions: 526 Number of sequences better than 10.0: 17 Number of HSP's gapped: 518 Number of HSP's successfully gapped: 18 Length of query: 135 Length of database: 6,723,737 Length adjustment: 86 Effective length of query: 49 Effective length of database: 6,469,177 Effective search space: 316989673 Effective search space used: 316989673 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 40 (20.0 bits)