TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= PFI1515w_changed | Plasmodium falciparum 3D7 | Sel2 protein|conserved Plasmodium selenoprotein | protein | length=229 (229 letters) Database: genome.fa 2960 sequences; 20,171,213 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Plasmodium_yoelii_yoelii_str._17XNL|MALPY00297|2002-09-10|ds-DNA... 28 4.7 Plasmodium_yoelii_yoelii_str._17XNL|MALPY00686|2002-09-10|ds-DNA... 27 5.7 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY00297|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 14918 Score = 27.7 bits (60), Expect = 4.7, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 4/36 (11%) Frame = -2 Query: 79 NKIKNYFD----ILNKGRETEIYFENNNYIVDNDQK 110 NKI Y D ILNK R+ I NNY+ +N++K Sbjct: 8011 NKIHEYIDKKILILNKTRDDNISSLENNYLEENERK 7904 >Plasmodium_yoelii_yoelii_str._17XNL|MALPY00686|2002-09-10|ds- DNA|Plasmodium_yoelii_TIGR Length = 7235 Score = 27.3 bits (59), Expect = 5.7, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = -1 Query: 80 KIKNYFDILNKGRETEIYFENNNYIVDNDQ 109 +IKN+ D+L + + YF+N+NY+ D D+ Sbjct: 6701 QIKNFLDVLKRDQIYRSYFDNHNYVYDFDK 6612 Database: genome.fa Posted date: Feb 25, 2008 2:31 PM Number of letters in database: 20,171,213 Number of sequences in database: 2960 Lambda K H 0.329 0.144 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2960 Number of Hits to DB: 10,121,387 Number of extensions: 294449 Number of successful extensions: 3911 Number of sequences better than 10.0: 179 Number of HSP's gapped: 3904 Number of HSP's successfully gapped: 191 Length of query: 229 Length of database: 6,723,737 Length adjustment: 93 Effective length of query: 136 Effective length of database: 6,448,457 Effective search space: 876990152 Effective search space used: 876990152 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 42 (20.8 bits)