TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= Sel2 (135 letters) Database: genoma.fa 14 sequences; 23,462,190 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Plasmodium_knowlesi_strain_H|PK4.chr13|2007-02-22|ds-DNA|Plasmod... 90 4e-19 Plasmodium_knowlesi_strain_H|PK4.chr11.pseudo.embl|2007-02-22|ds... 28 1.6 Plasmodium_knowlesi_strain_H|chr10|2007-02-22|ds-DNA|Plasmodium_... 27 3.8 >Plasmodium_knowlesi_strain_H|PK4.chr13|2007-02-22|ds- DNA|Plasmodium_knowlesi_Sanger Length = 2200295 Score = 89.7 bits (221), Expect = 4e-19, Method: Composition-based stats. Identities = 65/127 (51%), Positives = 87/127 (68%) Frame = -2 Query: 1 MDTNENMKNVKDMMSFTTKNIIYIFIGISLLIFIYKILKKNKKDAEVKRNNEISIKMKLS 60 MD N K + + KN+I + +G++ I IYK +K KK +E +R N+I KMK+S Sbjct: 1129870 MDREGNNAPTKGVDLLSVKNVILLVLGVTSFILIYKFMKYRKKVSEFERKNKIDEKMKMS 1129691 Query: 61 REKQLQELDKEMMINKEKMKEQNIKKNEEKKKDADQAKPKLGSKDNSSFNHLNDYSNYYR 120 REK+LQEL+KEM++NKEKM+EQ K N++K K D K K SKDNSSF+H D SNYYR Sbjct: 1129690 REKRLQELEKEMIVNKEKMREQMNKGNDKKDKALDSDKAKPDSKDNSSFSHFRDLSNYYR 1129511 Query: 121 PSLKNRF 127 PS++NR Sbjct: 1129510 PSIRNRL 1129490 >Plasmodium_knowlesi_strain_H|PK4.chr11.pseudo.embl|2007-02-22|ds- DNA|Plasmodium_knowlesi_Sanger Length = 2372884 Score = 28.1 bits (61), Expect = 1.6, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +1 Query: 28 ISLLIFIYKILKKNKKDAEVKRNNEISIKMKLSR 61 +S++IF+YK L K + RNNE S+ + L R Sbjct: 554800 LSVIIFLYKFLLFPKIKHSLARNNEQSVFLFLPR 554901 >Plasmodium_knowlesi_strain_H|chr10|2007-02-22|ds- DNA|Plasmodium_knowlesi_Sanger Length = 1486039 Score = 26.6 bits (57), Expect = 3.8, Method: Composition-based stats. Identities = 22/94 (23%), Positives = 45/94 (47%), Gaps = 2/94 (2%) Frame = -3 Query: 26 IGISLLIFIYKILKKNKKDAEVKRNNEISIKMKLSREKQLQELDKEMMINKEKMKEQNIK 85 +GIS+ + IY N+K+ +V + + K+ +E+D++ M E M + ++ Sbjct: 707783 LGISVPLDIY-----NRKENKVSHSPPNTPHAKIWDSNHFEEMDRQTMRTSESMHVKGLE 707619 Query: 86 K--NEEKKKDADQAKPKLGSKDNSSFNHLNDYSN 117 + NE+ + + P++GS + ND N Sbjct: 707618 ETHNEQPFSNVNNNAPRVGSNGTQQIHLPNDEMN 707517 Database: genoma.fa Posted date: Feb 29, 2008 11:22 AM Number of letters in database: 23,462,190 Number of sequences in database: 14 Lambda K H 0.316 0.132 0.353 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14 Number of Hits to DB: 3,682,479 Number of extensions: 69544 Number of successful extensions: 3595 Number of sequences better than 10.0: 14 Number of HSP's gapped: 3536 Number of HSP's successfully gapped: 678 Length of query: 135 Length of database: 7,820,730 Length adjustment: 87 Effective length of query: 48 Effective length of database: 7,819,512 Effective search space: 375336576 Effective search space used: 375336576 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 54 (25.4 bits) # TBLASTN 2.2.17 [Aug-26-2007] # Query: Sel2 # Database: genoma.fa # Fields: Query id, Subject id, % identity, alignment length, mismatches, gap openings, q. start, q. end, s. start, s. end, e-value, bit score Sel2 Plasmodium_knowlesi_strain_H|PK4.chr13|2007-02-22|ds-DNA|Plasmodium_knowlesi_Sanger 51.18 127 62 0 1 127 1129870 1129490 4e-19 89.7 Sel2 Plasmodium_knowlesi_strain_H|PK4.chr11.pseudo.embl|2007-02-22|ds-DNA|Plasmodium_knowlesi_Sanger 41.18 34 20 0 28 61 554800 554901 1.6 28.1 Sel2 Plasmodium_knowlesi_strain_H|chr10|2007-02-22|ds-DNA|Plasmodium_knowlesi_Sanger 23.40 94 70 2 26 117 707783 707517 3.8 26.6