TBLASTN 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= pstk_Drosophila_melanogaster (292 letters) Database: genoma.fa 14 sequences; 23,462,190 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Plasmodium_knowlesi_strain_H|chr02|2007-02-22|ds-DNA|Plasmodium_... 31 0.96 Plasmodium_knowlesi_strain_H|PK4.chr09|2007-02-22|ds-DNA|Plasmod... 30 1.1 Plasmodium_knowlesi_strain_H|chr14|2007-02-22|ds-DNA|Plasmodium_... 28 5.4 >Plasmodium_knowlesi_strain_H|chr02|2007-02-22|ds- DNA|Plasmodium_knowlesi_Sanger Length = 726886 Score = 30.8 bits (68), Expect = 0.96, Method: Composition-based stats. Identities = 21/49 (42%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -3 Query: 82 QVRRISSSGDYNSGRH-LILCDDNFYYRSMRYKLYQLCRDSGCIFGQIY 129 Q +R SS H LIL +D F+ SMR K Y LCR I IY Sbjct: 404501 QNQRCSSRQCRRKTEHVLILLNDTFHLPSMRKKYYLLCRKCMYI*PYIY 404355 >Plasmodium_knowlesi_strain_H|PK4.chr09|2007-02-22|ds- DNA|Plasmodium_knowlesi_Sanger Length = 2147124 Score = 30.4 bits (67), Expect = 1.1, Method: Composition-based stats. Identities = 18/82 (21%), Positives = 42/82 (51%), Gaps = 1/82 (1%) Frame = -3 Query: 129 YMASSLDSCLQANSLRSDATRVPVDVVRQMNERLEVPDTSEAWERNSLTLNGLDMDTTGS 188 + ++S C+ NS++ AT + + +R+E PD E W + + L+ + ++ Sbjct: 1617919 FSSASQIECVDENSIKKLATVLRKKKNKNERDRMEHPDNPEKWVMSEVDLDEILVNIKNL 1617740 Query: 189 ALLA-FIASLLDLPAMETTLDL 209 ++ + +S+++ ME +DL Sbjct: 1617739 SVCSNLYSSMVESEIMEDIIDL 1617674 >Plasmodium_knowlesi_strain_H|chr14|2007-02-22|ds- DNA|Plasmodium_knowlesi_Sanger Length = 3159096 Score = 28.1 bits (61), Expect = 5.4, Method: Composition-based stats. Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 12/63 (19%) Frame = +2 Query: 72 AIQEDTDWP----PQVR--------RISSSGDYNSGRHLILCDDNFYYRSMRYKLYQLCR 119 AIQ + P P++R RISS ++ H+ +C NF+ S L+ LC Sbjct: 2311169 AIQAEFSSPSFVIPRIRLKSPTGTCRISSVIHTHTHTHVCVCAGNFFVFSKSILLFPLCG 2311348 Query: 120 DSG 122 SG Sbjct: 2311349 QSG 2311357 Database: genoma.fa Posted date: Mar 11, 2008 12:17 PM Number of letters in database: 23,462,190 Number of sequences in database: 14 Lambda K H 0.322 0.138 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14 Number of Hits to DB: 7,237,971 Number of extensions: 104860 Number of successful extensions: 529 Number of sequences better than 10.0: 4 Number of HSP's gapped: 529 Number of HSP's successfully gapped: 5 Length of query: 292 Length of database: 7,820,730 Length adjustment: 97 Effective length of query: 195 Effective length of database: 7,819,372 Effective search space: 1524777540 Effective search space used: 1524777540 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 59 (27.3 bits) # TBLASTN 2.2.17 [Aug-26-2007] # Query: pstk_Drosophila_melanogaster # Database: genoma.fa # Fields: Query id, Subject id, % identity, alignment length, mismatches, gap openings, q. start, q. end, s. start, s. end, e-value, bit score pstk_Drosophila_melanogaster Plasmodium_knowlesi_strain_H|chr02|2007-02-22|ds-DNA|Plasmodium_knowlesi_Sanger 42.86 49 27 1 82 129 404501 404355 0.96 30.8 pstk_Drosophila_melanogaster Plasmodium_knowlesi_strain_H|PK4.chr09|2007-02-22|ds-DNA|Plasmodium_knowlesi_Sanger 21.95 82 63 1 129 209 1617919 1617674 1.1 30.4 pstk_Drosophila_melanogaster Plasmodium_knowlesi_strain_H|chr14|2007-02-22|ds-DNA|Plasmodium_knowlesi_Sanger 31.75 63 31 2 72 122 2311169 2311357 5.4 28.1