This version of the TRANSFAC database is free for users from non-profit organizations only.
Users from commercial organizations have to license the TRANSFAC databases and accompanying programs.
AC T02983
XX
ID T02983
XX
DT 23.02.2000 (created); rio.
DT 17.02.2005 (updated); vma.
CO Copyright (C), Biobase GmbH.
XX
FA Pax-4a
XX
SY mPax-4; mPAX4; Pax-4; PAX4.
XX
OS mouse, Mus musculus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
CL C0018 paired-homeo; 3.2.1.0.7.1..
XX
SZ 349 AA; 38.0 kDa (cDNA); 38 kDa (SDS) [1]
XX
SQ MQQDGLSSVNQLGGLFVNGRPLPLDTRQQIVQLAIRGMRPCDISRSLKVSNGCVSKILGR
SQ YYRTGVLEPKCIGGSKPRLATPAVVARIAQLKDEYPALFAWEIQHQLCTEGLCTQDKAPS
SQ VSSINRVLRALQEDQSLHWTQLRSPAVLAPVLPSPHSNCGAPRGPHPGTSHRNRTIFSPG
SQ QAEALEKEFQRGQYPDSVARGKLAAATSLPEDTVRVWFSNRRAKWRRQEKLKWEAQLPGA
SQ SQDLTVPKNSPGIISAQQSPGSVPSAALPVLEPLSPSFCQLCCGTAPGRCSSDTSSQAYL
SQ QPYWDCQSLLPVASSSYVEFAWPCLTTHPVHHLIGGPGQVPSTHCSNWP
XX
SC translated from EMBL #AB010558
XX
FT 5 132 
paired domain.
FT 5 129 
PF00292; PAX.
FT 5 129 
SM00351; PAX.
FT 169 228 
homeo domain.
FT 170 232 
SM00389; HOX.
FT 171 227 
PF00046; homeobox.
FT 231 349 
leucine-/proline-rich region (28/119).
FT 239 252 
missing in splice variant Pax-4b.
FT 278 314 
missing in splice variant Pax-4c.
FT 278 349 
activation and repression domain [1].
XX
SF Pax-4 gene presumably exists as a single copy in the genome [3];
SF the activation domain seems to be E1A-responsive whereas the repression domain is general active [1];
SF three splice variants found which were not named by the authors [4];
SF the C-terminal region (activation/repression domain) shows no significant homology with any other known Pax gene [4];
XX
CP MIN6, betaTC and NIT-1 cells [3]; (embryo 9.5 days:) ventral spinal cord, pancreas, (embryo 10.5 days:) dorsal pancreas, (embryo 11.0 days:) ventral pancreas, (newborn:) insulin-producing beta cells [5].
CN alphaTC cells [3]; (newborn:) pancreatic alpha and delta cells [5].
XX
FF homozygous knockout mice die after birth within 3 days showing growth retardation and dehydration (apparently as a consequence of insulin deficiency) [5];
FF differentiation of endocrine progenitors to beta and delta cells [5];
FF Pax-4 binds to islet hormone promoters (glucagon, insulin, somastatin) and can act competitive to Pax-6 as a repressor [1] [2];
XX
MX M00373 V$PAX4_01.
MX M00377 V$PAX4_02.
MX M00378 V$PAX4_03.
MX M00380 V$PAX4_04.
XX
BS R08708 AS$PAX4_01; Quality: 2.
BS R08709 AS$PAX4_02; Quality: 2.
BS R08711 AS$PAX4_03; Quality: 2.
BS R08712 AS$PAX4_04; Quality: 2.
BS R08713 AS$PAX4_05; Quality: 2.
BS R08714 AS$PAX4_06; Quality: 2.
BS R08715 AS$PAX4_07; Quality: 2.
BS R08716 AS$PAX4_08; Quality: 2.
BS R08717 AS$PAX4_09; Quality: 2.
BS R08718 AS$PAX4_10; Quality: 2.
BS R08719 AS$PAX4_11; Quality: 2.
BS R08720 AS$PAX4_12; Quality: 2.
BS R08721 AS$PAX4_13; Quality: 2.
BS R08722 AS$PAX4_14; Quality: 2.
BS R08723 AS$PAX4_15; Quality: 2.
BS R08724 AS$PAX4_16; Quality: 2.
BS R08725 AS$PAX4_17; Quality: 2.
BS R08726 AS$PAX4_18; Quality: 2.
BS R08727 AS$PAX4_19; Quality: 2.
BS R08728 AS$PAX4_20; Quality: 2.
BS R08729 AS$PAX4_21; Quality: 2.
BS R08730 AS$PAX4_22; Quality: 2.
BS R08731 AS$PAX4_23; Quality: 2.
BS R08732 AS$PAX4_24; Quality: 2.
BS R08733 AS$PAX4_25; Quality: 2.
BS R08734 AS$PAX4_26; Quality: 2.
BS R08735 AS$PAX4_27; Quality: 2.
BS R08736 AS$PAX4_28; Quality: 2.
BS R08737 AS$PAX4_29; Quality: 2.
BS R08738 AS$PAX4_30; Quality: 2.
BS R08739 AS$PAX4_31; Quality: 2.
BS R08740 AS$PAX4_32; Quality: 2.
BS R08741 AS$PAX4_33; Quality: 2.
BS R08742 AS$PAX4_34; Quality: 2.
BS R08743 AS$PAX4_35; Quality: 2.
BS R08744 AS$PAX4_36; Quality: 2.
BS R08745 AS$PAX4_37; Quality: 2.
BS R08746 AS$PAX4_38; Quality: 2.
BS R08748 AS$PAX4_39; Quality: 2.
BS R08749 AS$PAX4_40; Quality: 2.
BS R08750 AS$PAX4_41; Quality: 2.
BS R08751 AS$PAX4_42; Quality: 2.
BS R08752 AS$PAX4_43; Quality: 2.
BS R08753 AS$PAX4_44; Quality: 2.
BS R08754 AS$PAX4_45; Quality: 2.
BS R08755 AS$PAX4_46; Quality: 2.
BS R08756 AS$PAX4_47; Quality: 2.
BS R08757 AS$PAX4_48; Quality: 2.
BS R08758 AS$PAX4_49; Quality: 2.
BS R08759 AS$PAX4_50; Quality: 2.
BS R08760 AS$PAX4_51; Quality: 2.
BS R08762 AS$PAX4_52; Quality: 2.
BS R08763 AS$PAX4_53; Quality: 2.
BS R08764 AS$PAX4_54; Quality: 2.
BS R08765 AS$PAX4_55; Quality: 2.
BS R08766 AS$PAX4_56; Quality: 2.
BS R08767 AS$PAX4_57; Quality: 2.
BS R08768 AS$PAX4_58; Quality: 2.
BS R08769 AS$PAX4_59; Quality: 2.
BS R08770 AS$PAX4_60; Quality: 2.
BS R08771 AS$PAX4_61; Quality: 2.
BS R14646 HS$PAX4_01; Quality: 2; PAX4, G006532; human, Homo sapiens.
BS R14647 HS$PAX4_02; Quality: 2; PAX4, G006532; human, Homo sapiens.
BS R08703 RAT$GLU_06; Quality: 1; GLUC, G000741; rat, Rattus norvegicus.
BS R08777 RAT$GLU_08; Quality: 1; GLUC, G000741; rat, Rattus norvegicus.
BS R08705 RAT$INS1_16; Quality: 1; ins-1, G000760; rat, Rattus norvegicus.
BS R08706 RAT$SSTA_06; Quality: 1; SOM, G000795; rat, Rattus norvegicus.
XX
DR TRANSPATH: MO000026934.
DR BKL: HumanPSD: Pax4; Mouse.
DR EMBL: AB010558.
DR SWISSPROT: P32115.
DR PIR: A41061; A41061.
XX
RN [1]; RE0014123.
RX PUBMED: 10567553.
RA Fujitani Y., Kajimoto Y., Yasuda T., Matsuoka T. A., Kaneto H., Umayahara Y., Fujita N., Watada H., Miyazaki J. I., Yamasaki Y., Hori M.
RT Identification of a portable repression domain and an E1A-responsive activation domain in Pax4: a possible role of Pax4 as a transcriptional repressor in the pancreas
RL Mol. Cell. Biol. 19:8281-8291 (1999).
RN [2]; RE0014138.
RX PUBMED: 10567552.
RA Smith S. B., Ee H. C., Conners J. R., German M. S.
RT Paired-homeodomain transcription factor PAX4 acts as a transcriptional repressor in early pancreatic development
RL Mol. Cell. Biol. 19:8272-8280 (1999).
RN [3]; RE0014120.
RX PUBMED: 9439631.
RA Matsushita T., Yamaoka T., Otsuka S., Moritani M., Matsumoto T., Itakura M.
RT Molecular cloning of mouse paired-box-containing gene (Pax)-4 from an islet beta cell line and deduced sequence of human Pax-4
RL Biochem. Biophys. Res. Commun. 242:176-180 (1998).
RN [4]; RE0014280.
RX PUBMED: 9480859.
RA Inoue H., Nomiyama J., Nakai K., Matsutani A., Tanizawa Y., Oka Y.
RT Isolation of full-length cDNA of mouse PAX4 gene and identification of its human homologue
RL Biochem. Biophys. Res. Commun. 243:628-633 (1998).
RN [5]; RE0006104.
RX PUBMED: 9121556.
RA Sosa-Pineda B., Chowdhury K., Torres M., Oliver G., Gruss P.
RT The Pax4 gene is essential for differentiation of insulin-producing beta cells in the mammalian pancreas
RL Nature 386:399-402 (1997).
RN [6]; RE0006130.
RX PUBMED: 9163426.
RA St-Onge L., Sosa-Pineda B., Chowdhury K., Mansouri A., Gruss P.
RT Pax6 is required for differentiation of glucagon-producing alpha -cells in mouse pancreas
RL Nature 387:406-409 (1997).
RN [7]; RE0004257.
RX PUBMED: 1685142.
RA Walther C., Guenet J. L., Simon D., Deutsch U., Jostes B., Goulding M. D., Plachov D., Balling R., Gruss P.
RT Pax: a murine multigene family of paired box-containing genes
RL Genomics 11:424-434 (1991).
XX
//
This version of the TRANSFAC database is free for users from non-profit organizations only.
Users from commercial organizations have to license the TRANSFAC databases and accompanying programs.