TRANSFAC-Logo

This version of the TRANSFAC database is free for users from non-profit organizations only.
Users from commercial organizations have to license the TRANSFAC databases and accompanying programs.

TRANSFAC FACTOR TABLE, Release 7.0 - public - 2005-09-30, (C) Biobase GmbH


AC T01049 XX ID T01049 XX DT 22.02.1994 (created); ewi. DT 12.09.2005 (updated); ili. CO Copyright (C), Biobase GmbH. XX FA HNF-3beta XX SY Foxa2; HNF3B; HNF3beta. XX OS rat, Rattus norvegicus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G001172 HNF-3beta. XX CL C0023 fork head; 3.3.2.0.2.. XX SZ 458 AA; 48.5 kDa (cDNA), 46 kDa (SDS) XX SQ MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNASLGMNGMNTYMSMSAAAMGSGSGNMSA SQ GSMNMSSYVGAGMSPSLAGMSPGAGAMAGMSGSAGAAGVAGMGPHLSPSLSPLGGQAAGA SQ MGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKML SQ TLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDFLKVPRAPDKPGKGSFWTLHPDSGN SQ MFENGCYLRRQKRFKCENELALKEAAGAGSGGGKKTAPGTQASQVQLGEAAGSASETPAG SQ TESPHSSASPCQEHKRGGLSELKGTPASALSPPEPAPSPGQQQQAAAHLLGPPHHPGLPP SQ EAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKTYEQVMHYPGGYGSPMP SQ GSLAMGPVTNKAGLDASPLAADTSYYQGVYSRPIMNSS XX SC SwissProt #P32182 XX FT 14 93 transcriptional activation domain, contains two putative CKI phosphorylation sites [5]. FT 157 255 fork head domain [2]. FT 157 257 DNA-binding domain, contains NLS (nuclear localization signal). FT 157 246 SM00339; FH. FT 159 253 PF00250; Fork_head. FT 186 205 contributes to DNA binding specificity. FT 372 458 primary transcription activation domain. XX CP liver (intestine, lung, stomach, ovary). XX FF activator; FF involved in regulation of liver and intestinal gene expression [4]; FF was known as OB2 [3]; FF cell type-specific protein in neuronal cells [3] [1]; FF acts synergistically with USF [3] [1]; XX MX M00131 V$HNF3B_01. XX BS R05086 DHBV$DHBV_02; Quality: 1; DHBV, G000083; DHBV, duck hepatitis B virus. BS R02177 HNF3B$CONS; Quality: 2. BS R05105 HS$ALPI_01; Quality: 6; ALPI, G005245; human, Homo sapiens. BS R03666 HS$APOB_15; Quality: 6; apoB, G000205; human, Homo sapiens. BS R08918 HS$APOB_40; Quality: 2; apoB, G000205; human, Homo sapiens. BS R04663 HS$IGFBP1_02; Quality: 2; IGFBP-1, G000310; human, Homo sapiens. BS R17151 HS$IPF1_02; Quality: 4; IPF1, G002249; human, Homo sapiens. BS R17150 HS$IPF1_03; Quality: 2; IPF1, G002249; human, Homo sapiens. BS R17157 HS$IPF1_05; Quality: 6; IPF1, G002249; human, Homo sapiens. BS R05104 HS$MSH2_01; Quality: 6; MSH2, G001231; human, Homo sapiens. BS R15361 HS$NEUROG3_01; Quality: 2; Neurog3, G009796; human, Homo sapiens. BS R15362 HS$NEUROG3_02; Quality: 2; Neurog3, G009796; human, Homo sapiens. BS R05076 HS$PRTC_01; Quality: 2; Protein C precursor, G001228; human, Homo sapiens. BS R05084 HS$TTF1_01; Quality: 3; TTF-1, G001229; human, Homo sapiens. BS R05085 HS$TTF1_02; Quality: 3; TTF-1, G001229; human, Homo sapiens. BS R08919 MOUSE$A1ANTR_04; Quality: 2; AAT, G000472; mouse, Mus musculus. BS R05101 MOUSE$CDX2_01; Quality: 6; Cdx2, G001230; mouse, Mus musculus. BS R05102 MOUSE$ECADH_03; Quality: 6; CAD1, G000503; mouse, Mus musculus. BS R16569 MOUSE$FOXA1_04; Quality: 3; FOXA1, G013744; mouse, Mus musculus. BS R04324 MOUSE$HNF3B_02; Quality: 6; HNF-3beta, G001010; mouse, Mus musculus. BS R01464 MOUSE$TTPA_04; Quality: 2; TTR, G000625; mouse, Mus musculus. BS R03444 MOUSE$TTPA_07; Quality: 2; TTR, G000625; mouse, Mus musculus. BS R08916 RAT$AFEP_16; Quality: 2; AFP, G000691; rat, Rattus norvegicus. BS R01800 RAT$ALDB_03; Quality: 6; ALDB, G000687; rat, Rattus norvegicus. BS R08920 RAT$AMGL_03; Quality: 2; A2-Mag, G000699; rat, Rattus norvegicus. BS R05017 RAT$CCSP_01; Quality: 1; CCSP, G001149; rat, Rattus norvegicus. BS R05103 RAT$FABPI_04; Quality: 6; FABPI, G001738; rat, Rattus norvegicus. BS R16547 RAT$FOXA1_03; Quality: 3; Foxa1, G013745; rat, Rattus norvegicus. BS R00581 RAT$GLU_02; Quality: 1; GLUC, G000741; rat, Rattus norvegicus. BS R05078 RAT$HNF1_03; Quality: 6; HNF-1, G000756; rat, Rattus norvegicus. BS R05073 RAT$IGFBP1_01; Quality: 1; IGFBP-1, G001207; rat, Rattus norvegicus. BS R08139 RAT$KINK_02; Quality: 3; KIN-K, G001029; rat, Rattus norvegicus. BS R08137 RAT$KINT1_04; Quality: 3; KIN-T1, G001028; rat, Rattus norvegicus. BS R02350 RAT$PEPCK_16; Quality: 3; PEPCK, G000782; rat, Rattus norvegicus. BS R04662 RAT$PEPCK_19; Quality: 3; PEPCK, G000782; rat, Rattus norvegicus. BS R02989 RAT$PFK_05; Quality: 3; PFK-2/FBPase-2, G000784; rat, Rattus norvegicus. BS R05015 RAT$T1A_04; Quality: 2; T1alpha, G001148; rat, Rattus norvegicus. BS R03150 RAT$TAT_25; Quality: 6; TAT, G000798; rat, Rattus norvegicus. BS R05029 RAT$TAT_29; Quality: 1; TAT, G000798; rat, Rattus norvegicus. BS R08917 RAT$TOA_04; Quality: 2; TO, G000803; rat, Rattus norvegicus. BS R04321 RAT$TPO_04; Quality: 3; TPO, G001009; rat, Rattus norvegicus. XX DR TRANSPATH: MO000045363. DR BKL: HumanPSD: Foxa2; Rat. DR TRANSCOMPEL: C00037. DR TRANSCOMPEL: C00277. DR EMBL: L09647. DR SWISSPROT: P32182. XX RN [1]; RE0035145. RX PUBMED: 15385550. RA Viney T. J., Schmidt T. W., Gierasch W., Sattar A. W., Yaggie R. E., Kuburas A., Quinn J. P., Coulson J. M., Russo A. F. RT Regulation of the cell-specific calcitonin/calcitonin gene-related peptide enhancer by USF and the Foxa2 forkhead protein. RL J. Biol. Chem. 279:49948-49955 (2004). RN [2]; RE0006655. RA TRANSFAC_Team. RT Revisions of transcription factor domains RL TRANSFAC Reports 1:0002 (1998). RN [3]; RE0016372. RX PUBMED: 9218472. RA Lanigan T. M., Russo A. F. RT Binding of upstream stimulatory factor and a cell-specific activator to the calcitonin/calcitonin gene-related peptide enhancer. RL J. Biol. Chem. 272:18316-18324 (1997). RN [4]; RE0014471. RX PUBMED: 8887657. RA Samadani U., Costa R. H. RT The transcriptional activator hepatocyte nuclear factor 6 regulates liver gene expression RL Mol. Cell. Biol. 16:6273-6284 (1996). RN [5]; RE0006536. RX PUBMED: 7739897. RA Qian X., Costa R. H. RT Analysis of hepatocyte nuclear factor-3beta protein domains required for transcriptional activation and nuclear targeting RL Nucleic Acids Res. 23:1184-1191 (1995). RN [6]; RE0003012. RX PUBMED: 8139574. RA Overdier D. G., Porcella A., Costa R. H. RT The DNA-binding specificity of the hepatocyte nuclear factor 3/forkhead domain is influenced by amino acid residues adjacent to the recognition helix RL Mol. Cell. Biol. 14:2755-2766 (1994). RN [7]; RE0000288. RX PUBMED: 1638120. RA Sladek F. M., Darnell J. E. RT Mechanisms of liver-specific gene expression RL Curr. Opin. Gen. Dev. 2:256-259 (1992). RN [8]; RE0001695. RX PUBMED: 1324404. RA Pani L., Overdier D. G., Porcella A., Qian X., Lai E., Costa R. H. RT Hepatocyte nuclear factor 3beta contains two transcriptional activation domains, one of which is novel and conserved with the Drosophila fork head protein RL Mol. Cell. Biol. 12:3723-3732 (1992). RN [9]; RE0000676. RX PUBMED: 2227418. RA Lai E., Prezioso V. R., Smith E., Litvin O., Costa R. H., Darnell J. E. RT HNF-3A, a hepatocyte-enriched transcription factor of novel structure is regulated transcriptionally RL Genes Dev. 4:1427-1436 (1990). XX //

This version of the TRANSFAC database is free for users from non-profit organizations only.
Users from commercial organizations have to license the TRANSFAC databases and accompanying programs.