This version of the TRANSFAC database is free for users from non-profit organizations only.
Users from commercial organizations have to license the TRANSFAC databases and accompanying programs.
AC T01049
XX
ID T01049
XX
DT 22.02.1994 (created); ewi.
DT 12.09.2005 (updated); ili.
CO Copyright (C), Biobase GmbH.
XX
FA HNF-3beta
XX
SY Foxa2; HNF3B; HNF3beta.
XX
OS rat, Rattus norvegicus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G001172 HNF-3beta.
XX
CL C0023 fork head; 3.3.2.0.2..
XX
SZ 458 AA; 48.5 kDa (cDNA), 46 kDa (SDS)
XX
SQ MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNASLGMNGMNTYMSMSAAAMGSGSGNMSA
SQ GSMNMSSYVGAGMSPSLAGMSPGAGAMAGMSGSAGAAGVAGMGPHLSPSLSPLGGQAAGA
SQ MGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKML
SQ TLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDFLKVPRAPDKPGKGSFWTLHPDSGN
SQ MFENGCYLRRQKRFKCENELALKEAAGAGSGGGKKTAPGTQASQVQLGEAAGSASETPAG
SQ TESPHSSASPCQEHKRGGLSELKGTPASALSPPEPAPSPGQQQQAAAHLLGPPHHPGLPP
SQ EAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKTYEQVMHYPGGYGSPMP
SQ GSLAMGPVTNKAGLDASPLAADTSYYQGVYSRPIMNSS
XX
SC SwissProt #P32182
XX
FT 14 93 
transcriptional activation domain, contains two putative CKI phosphorylation sites [5].
FT 157 255 
fork head domain [2].
FT 157 257 
DNA-binding domain, contains NLS (nuclear localization signal).
FT 157 246 
SM00339; FH.
FT 159 253 
PF00250; Fork_head.
FT 186 205 
contributes to DNA binding specificity.
FT 372 458 
primary transcription activation domain.
XX
CP liver (intestine, lung, stomach, ovary).
XX
FF activator;
FF involved in regulation of liver and intestinal gene expression [4];
FF was known as OB2 [3];
FF cell type-specific protein in neuronal cells [3] [1];
FF acts synergistically with USF [3] [1];
XX
MX M00131 V$HNF3B_01.
XX
BS R05086 DHBV$DHBV_02; Quality: 1; DHBV, G000083; DHBV, duck hepatitis B virus.
BS R02177 HNF3B$CONS; Quality: 2.
BS R05105 HS$ALPI_01; Quality: 6; ALPI, G005245; human, Homo sapiens.
BS R03666 HS$APOB_15; Quality: 6; apoB, G000205; human, Homo sapiens.
BS R08918 HS$APOB_40; Quality: 2; apoB, G000205; human, Homo sapiens.
BS R04663 HS$IGFBP1_02; Quality: 2; IGFBP-1, G000310; human, Homo sapiens.
BS R17151 HS$IPF1_02; Quality: 4; IPF1, G002249; human, Homo sapiens.
BS R17150 HS$IPF1_03; Quality: 2; IPF1, G002249; human, Homo sapiens.
BS R17157 HS$IPF1_05; Quality: 6; IPF1, G002249; human, Homo sapiens.
BS R05104 HS$MSH2_01; Quality: 6; MSH2, G001231; human, Homo sapiens.
BS R15361 HS$NEUROG3_01; Quality: 2; Neurog3, G009796; human, Homo sapiens.
BS R15362 HS$NEUROG3_02; Quality: 2; Neurog3, G009796; human, Homo sapiens.
BS R05076 HS$PRTC_01; Quality: 2; Protein C precursor, G001228; human, Homo sapiens.
BS R05084 HS$TTF1_01; Quality: 3; TTF-1, G001229; human, Homo sapiens.
BS R05085 HS$TTF1_02; Quality: 3; TTF-1, G001229; human, Homo sapiens.
BS R08919 MOUSE$A1ANTR_04; Quality: 2; AAT, G000472; mouse, Mus musculus.
BS R05101 MOUSE$CDX2_01; Quality: 6; Cdx2, G001230; mouse, Mus musculus.
BS R05102 MOUSE$ECADH_03; Quality: 6; CAD1, G000503; mouse, Mus musculus.
BS R16569 MOUSE$FOXA1_04; Quality: 3; FOXA1, G013744; mouse, Mus musculus.
BS R04324 MOUSE$HNF3B_02; Quality: 6; HNF-3beta, G001010; mouse, Mus musculus.
BS R01464 MOUSE$TTPA_04; Quality: 2; TTR, G000625; mouse, Mus musculus.
BS R03444 MOUSE$TTPA_07; Quality: 2; TTR, G000625; mouse, Mus musculus.
BS R08916 RAT$AFEP_16; Quality: 2; AFP, G000691; rat, Rattus norvegicus.
BS R01800 RAT$ALDB_03; Quality: 6; ALDB, G000687; rat, Rattus norvegicus.
BS R08920 RAT$AMGL_03; Quality: 2; A2-Mag, G000699; rat, Rattus norvegicus.
BS R05017 RAT$CCSP_01; Quality: 1; CCSP, G001149; rat, Rattus norvegicus.
BS R05103 RAT$FABPI_04; Quality: 6; FABPI, G001738; rat, Rattus norvegicus.
BS R16547 RAT$FOXA1_03; Quality: 3; Foxa1, G013745; rat, Rattus norvegicus.
BS R00581 RAT$GLU_02; Quality: 1; GLUC, G000741; rat, Rattus norvegicus.
BS R05078 RAT$HNF1_03; Quality: 6; HNF-1, G000756; rat, Rattus norvegicus.
BS R05073 RAT$IGFBP1_01; Quality: 1; IGFBP-1, G001207; rat, Rattus norvegicus.
BS R08139 RAT$KINK_02; Quality: 3; KIN-K, G001029; rat, Rattus norvegicus.
BS R08137 RAT$KINT1_04; Quality: 3; KIN-T1, G001028; rat, Rattus norvegicus.
BS R02350 RAT$PEPCK_16; Quality: 3; PEPCK, G000782; rat, Rattus norvegicus.
BS R04662 RAT$PEPCK_19; Quality: 3; PEPCK, G000782; rat, Rattus norvegicus.
BS R02989 RAT$PFK_05; Quality: 3; PFK-2/FBPase-2, G000784; rat, Rattus norvegicus.
BS R05015 RAT$T1A_04; Quality: 2; T1alpha, G001148; rat, Rattus norvegicus.
BS R03150 RAT$TAT_25; Quality: 6; TAT, G000798; rat, Rattus norvegicus.
BS R05029 RAT$TAT_29; Quality: 1; TAT, G000798; rat, Rattus norvegicus.
BS R08917 RAT$TOA_04; Quality: 2; TO, G000803; rat, Rattus norvegicus.
BS R04321 RAT$TPO_04; Quality: 3; TPO, G001009; rat, Rattus norvegicus.
XX
DR TRANSPATH: MO000045363.
DR BKL: HumanPSD: Foxa2; Rat.
DR TRANSCOMPEL: C00037.
DR TRANSCOMPEL: C00277.
DR EMBL: L09647.
DR SWISSPROT: P32182.
XX
RN [1]; RE0035145.
RX PUBMED: 15385550.
RA Viney T. J., Schmidt T. W., Gierasch W., Sattar A. W., Yaggie R. E., Kuburas A., Quinn J. P., Coulson J. M., Russo A. F.
RT Regulation of the cell-specific calcitonin/calcitonin gene-related peptide enhancer by USF and the Foxa2 forkhead protein.
RL J. Biol. Chem. 279:49948-49955 (2004).
RN [2]; RE0006655.
RA TRANSFAC_Team.
RT Revisions of transcription factor domains
RL TRANSFAC Reports 1:0002 (1998).
RN [3]; RE0016372.
RX PUBMED: 9218472.
RA Lanigan T. M., Russo A. F.
RT Binding of upstream stimulatory factor and a cell-specific activator to the calcitonin/calcitonin gene-related peptide enhancer.
RL J. Biol. Chem. 272:18316-18324 (1997).
RN [4]; RE0014471.
RX PUBMED: 8887657.
RA Samadani U., Costa R. H.
RT The transcriptional activator hepatocyte nuclear factor 6 regulates liver gene expression
RL Mol. Cell. Biol. 16:6273-6284 (1996).
RN [5]; RE0006536.
RX PUBMED: 7739897.
RA Qian X., Costa R. H.
RT Analysis of hepatocyte nuclear factor-3beta protein domains required for transcriptional activation and nuclear targeting
RL Nucleic Acids Res. 23:1184-1191 (1995).
RN [6]; RE0003012.
RX PUBMED: 8139574.
RA Overdier D. G., Porcella A., Costa R. H.
RT The DNA-binding specificity of the hepatocyte nuclear factor 3/forkhead domain is influenced by amino acid residues adjacent to the recognition helix
RL Mol. Cell. Biol. 14:2755-2766 (1994).
RN [7]; RE0000288.
RX PUBMED: 1638120.
RA Sladek F. M., Darnell J. E.
RT Mechanisms of liver-specific gene expression
RL Curr. Opin. Gen. Dev. 2:256-259 (1992).
RN [8]; RE0001695.
RX PUBMED: 1324404.
RA Pani L., Overdier D. G., Porcella A., Qian X., Lai E., Costa R. H.
RT Hepatocyte nuclear factor 3beta contains two transcriptional activation domains, one of which is novel and conserved with the Drosophila fork head protein
RL Mol. Cell. Biol. 12:3723-3732 (1992).
RN [9]; RE0000676.
RX PUBMED: 2227418.
RA Lai E., Prezioso V. R., Smith E., Litvin O., Costa R. H., Darnell J. E.
RT HNF-3A, a hepatocyte-enriched transcription factor of novel structure is regulated transcriptionally
RL Genes Dev. 4:1427-1436 (1990).
XX
//
This version of the TRANSFAC database is free for users from non-profit organizations only.
Users from commercial organizations have to license the TRANSFAC databases and accompanying programs.