TRANSFAC-Logo

This version of the TRANSFAC database is free for users from non-profit organizations only.
Users from commercial organizations have to license the TRANSFAC databases and accompanying programs.

TRANSFAC FACTOR TABLE, Release 7.0 - public - 2005-09-30, (C) Biobase GmbH


AC T00100 XX ID T00100 XX DT 15.10.1992 (created); ewi. CO Copyright (C), Biobase GmbH. XX FA CUTL1 XX SY CCAAT displacement protein; CDP; Clox; cut homeodomain protein; cut-like homeodomain protein; Cux. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G004658 CUTL1; HGNC: Cutl1. XX HO cut (Drosophila) T02004. XX CL C0006 homeo; 3.1.1.4.1.. XX SZ 1505 AA; 164.4 kDa (cDNA), 180-200 kDa (SDS) XX SQ MLCVRGARLKRELDATATVLANRQDESEQSRKRLIEQSREFKKNTPEDLRKQVAPLLKSF SQ QGEIDALSKRSKEAEAAFLNVYKRLIDVPDPVPALDLGQQLQLKVQRLHDIETENQKLRE SQ TLEEYNKEFAEVKNQEVTIKALKEKIREYEQTLKNQAETIALEKEQKLQNDFAEKERKLQ SQ ETQMSTTSKLEEAEHKVQSLQTALEKTRTELFDLKTKYDEETTAKADEIEMIMTDLERAN SQ QRAEVAQREAETLREQLSSANHSLQLASQIQKAPDVEQAIEVLTRSSLEVELAAKEREIA SQ QLVEDVQRLQASLTKLRENSASQISQLEQQLSAKNSTLKQLEEKLKGQADYEEVKKELNI SQ LKSMEFAPSEGAGTQDAAKPLEVLLLEKNRSLQSENAALRISNSDLSGSARRKGKDQPES SQ RRPGSLPAPPPSQLPRNPGEQASNTNGTHQFSPAGLSQDFFSSSLASPSLPLASTGKFAL SQ NSLLQRQLMQSFYSKAMQEAGSTSMIFSTGPYSTNSISSQSPLQQSPDVNGMAPSPSQSE SQ SAGSVSEGEEMDTAEIARQVKEQLIKHNIGQRIFGHYVLGLSQGSVSEILARPKPWNKLT SQ VRGKEPFHKMKQFLSDEQNILALRSIQGRQRENPGQSLNRLFQEVPKRRNGSEGNITTRI SQ RASETGSDEAIKSILEQAKRELQVQKTAEPAQPSSASGSGNSDEPIRSILQQARREMEAQ SQ QAALDPALKQAPLSQSDITILTPKLLSTSPMPTVSSYPPLAISLKKPSAAPEAGASALPN SQ PPALKKEAQDAPGLDPQGAADCAQGVLRQVKNEVGRSGAWKDHWWSAVQPERRNAASSEE SQ AKARETGGGKEKGSGGSGGGSQPRAERSQLQGPSSSEYWKEWPSAESPYSQSSELSLTGA SQ SRSETPQNSPLPSSPIVPMSKPTKPSVPPLTPEQYEVYMYQEVDTIELTRQVKEKLAKNG SQ ICQRIFGEKVLGLSQGSVSDMLSRPKPWSKLTQKGREPFIRMQLWLNGELGQGVLPVQGQ SQ QQGPVLHSVTSLQDPLQQGCVSSESTPKTSASCSPAPESPMSSSESVKSLTELVQQPCPP SQ IEASKDSKPPEPSDPPASDSQPTTPLPLSGHSALSIQELVAMSPELDTYGITKRVKEVLT SQ DNNLGQRLFGETILGLTQGSVSDLLARPKPWHKLSLKGREPFVRMQLWLNDPNNVEKLMD SQ MKRMEKKAYMKRRHSSVSDSQPCEPPSVGTEYSQGASPQPQHQLKKPRVVLAPEEKEALK SQ RAYQQKPYPSPKTIEDLATQLNLKTSTVINWFHNYRSRIRRELFIEEIQAGSQGQAGASD SQ SPSARSGRAAPSSEGDSCDGVEATEGPGSADTEEPKSQGEAEREEVPRPAEQTEPPPSGT SQ PGPDDARDDDHEGGPVEGPGPLPSPASATATAAPAAPEDAATSAAAAPGEGPAAPTSAPP SQ PSNSSSSSAPRRPSSLQSLFGLPEAAGARDSRDNPLRKKKAANLNSIIHRLEKAASREEP SQ IEWEF XX SC SwissProt #P39880 XX FT 542 629 PF02376; CUT. FT 551 610 Cut-repeat 1 (CR1). FT 551 610 involved in binding to S/MAR-binding factor SATB1 [2]. FT 632 653 missing in putative splice variant. FT 934 1021 PF02376; CUT. FT 943 1007 Cut-repeat 2 (CR2). FT 943 1007 involved in binding to S/MAR-binding factor SATB1 [2]. FT 1117 1204 PF02376; CUT. FT 1135 1190 Cut-repeat 3 (CR3). FT 1244 1306 SM00389; HOX. FT 1245 1301 homeo domain. FT 1245 1301 involved in binding to S/MAR-binding factor SATB1 [2]. FT 1245 1301 PF00046; homeobox. XX SF the Clox homolog is a splice variant [6]; SF the 3 cut repeats also contribute to DNA-binding, each individual repeat and each combination exhibiting slightly different DNA-binding specificity [5] [6] [3]; SF CR1 exhibits the most restricted recognition pattern [5]; SF KD (CR3-homeo domain) = 0.03 nM, isolated CR3 at least 100-fold lower affinity [3]; XX FF repressor [10] [7] [4] [9] [13] [14]; FF transcription factor, look up the TRANSFAC cross reference for more details; FF may regulate S/MAR-binding factor SATB1 and may be regulated by it via protein-protein interaction [2]; XX MX M00095 V$CDP_01. MX M00102 V$CDP_02. MX M00104 V$CDPCR1_01. MX M00105 V$CDPCR3_01. MX M00106 V$CDPCR3HD_01. XX BS R03477 HS$CYBH_01; Quality: 2; gp91-phox, G000274; human, Homo sapiens. BS R00562 HS$GG_16; Quality: 6; GLOB-AG, G000261; human, Homo sapiens. XX DR TRANSPATH: MO000024708. DR BKL: HumanPSD: CUTL1; Human. DR SMARTDB: SB000079. DR EMBL: M74099. DR SWISSPROT: P39880. XX RN [1]; RE0017861. RX PUBMED: 10684263. RA Stuenkel W., Huang Z., Tan S.-H., O'Connor M. J., Bernard H.-U. RT Nuclear matrix attachment regions of human papillomavirus type 16 repress or activate the E6 promoter, depending on the physical state of the viral DNA RL J. Virol. 74:2489-2501 (2000). RN [2]; RE0015021. RX PUBMED: 10373541. RA Liu J., Barnett A., Neufeld E. J., Dudley J. P. RT Homeoproteins CDP and SATB1interact: potential for tissue-specific regulation RL Mol. Cell. Biol. 19:4918-4926 (1999). RN [3]; RE0002973. RX PUBMED: 7799919. RA Harada R., Berube G., Tamplin O. J., Denis-Larose C., Nepveu A. RT DNA-binding specificity of the cut repeats from the human cut-like protein RL Mol. Cell. Biol. 15:129-140 (1995). RN [4]; RE0003999. RX PUBMED: 7759529. RA Lievens P. M., Donady J. J., Tufarelli C., Neufeld E. J. RT Repressor activity of CCAAT displacement protein in HL-60 myeloid leukemia cells RL J. Biol. Chem. 270:12745-12750 (1995). RN [5]; RE0002967. RX PUBMED: 7914370. RA Aufiero B., Neufeld E. J., Orkin S. H. RT Sequence-specific DNA binding of individual cut repeats of the human CCAAT displacement/ cut homeodomain protein RL Proc. Natl. Acad. Sci. USA 91:7757-7761 (1994). RN [6]; RE0002972. RX PUBMED: 7905452. RA Andres V., Chiara M. D., Mahdavi V. RT A new bipartite DNA-binding domain: cooperative interaction between the cut repeat and homeo domain of the cut homeo proteins RL Genes Dev. 8:245-257 (1994). RN [7]; RE0003358. RX PUBMED: 8196661. RA Dufort D., Nepveu A. RT The human Cut homeodomain protein represses transcription from the c-myc promoter RL Mol. Cell. Biol. 14:4251-4257 (1994). RN [8]; RE0005004. RX PUBMED: 7904999. RA Harada R., Dufort D., Denis-Larose C., Nepveu A. RT Conserved cut repeats in the human cut homeodomain protein function as DNA binding domains RL J. Biol. Chem. 269:2062-2067 (1994). RN [9]; RE0005002. RX PUBMED: 1301999. RA Neufeld E. J., Skalnik D. G., Lievens P. M., Orkin S. H. RT Human CCAAT dis-placement protein is homologous to the Drosophila homeoprotein, cut RL Nat. Genet. 1:50-55 (1992). RN [10]; RE0001031. RX PUBMED: 1885602. RA Skalnik D. G., Strauss E. C., Orkin S. H. RT CCAAT displacement protein as a repressor of the myelomonocytic-specific gp91-phox gene promoter RL J. Biol. Chem. 266:16736-16744 (1991). RN [11]; RE0002047. RX PUBMED: 2476717. RA Mantovani R., Superti-Furga G., Gilman J., Ottolenghi S. RT The deletion of the distal CCAAT box region of the Agamma-globin gene in black HPFH abolishes the binding of the erythroid specific protein NFE3 and of the CCAAT displacement protein RL Nucleic Acids Res. 17:6681-6691 (1989). RN [12]; RE0005005. RX PUBMED: 2784063. RA Superti-Furga G., Barberis A., Schaffner G., Busslinger M. RT The protein CDP, but not CP1, footprints on the CCAAT region of the g-globin gene in unfractionated B-cell extracts RL Biochim. Biophys. Acta 1007:237-242 (1989). RN [13]; RE0000346. RX PUBMED: 3181130. RA Superti-Furga G., Barberis A., Schaffner G., Busslinger M. RT The -117 mutation in Greek HPFH affects the binding of three nuclear factors to the CCAAT region of the gamma-globin gene RL EMBO J. 7:3099-3107 (1988). RN [14]; RE0000079. RX PUBMED: 3607873. RA Barberis A., Superti-Furga G., Busslinger M. RT Mutually Exclusive Interaction of the CCAAT-Binding Factor and of a Displacement Protein with Overlapping Sequences of a Histone Gene Promoter RL Cell 50:347-359 (1987). XX //

This version of the TRANSFAC database is free for users from non-profit organizations only.
Users from commercial organizations have to license the TRANSFAC databases and accompanying programs.